Galectin 8 (LGALS8) (NM_006499) Human Mass Spec Standard

SKU
PH320102
LGALS8 MS Standard C13 and N15-labeled recombinant protein (NP_006490)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC220102]
Predicted MW 40.2 kDa
Protein Sequence
Protein Sequence
>RC220102 representing NM_006499
Red=Cloning site Green=Tags(s)

MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRF
KRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGI
YGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLPSNRGGDISKIAPRTVYTKSKDSTVNH
TLTCTKIPPMNYVSKRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKA
FVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGD
IHLLEVRSW

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006490
RefSeq Size 2996
RefSeq ORF 1077
Synonyms Gal-8; PCTA-1; PCTA1; Po66-CBP
Locus ID 3964
UniProt ID O00214
Cytogenetics 1q43
Summary This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Galectin 8 (LGALS8) (NM_006499) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH303752 LGALS8 MS Standard C13 and N15-labeled recombinant protein (NP_963838) 10 ug
$3,255.00
PH320163 LGALS8 MS Standard C13 and N15-labeled recombinant protein (NP_963837) 10 ug
$3,255.00
LC404450 LGALS8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404451 LGALS8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404452 LGALS8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC416600 LGALS8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404450 Transient overexpression lysate of lectin, galactoside-binding, soluble, 8 (LGALS8), transcript variant 2 100 ug
$436.00
LY404451 Transient overexpression lysate of lectin, galactoside-binding, soluble, 8 (LGALS8), transcript variant 3 100 ug
$436.00
LY404452 Transient overexpression lysate of lectin, galactoside-binding, soluble, 8 (LGALS8), transcript variant 4 100 ug
$436.00
LY416600 Transient overexpression lysate of lectin, galactoside-binding, soluble, 8 (LGALS8), transcript variant 1 100 ug
$436.00
TP303752 Recombinant protein of human lectin, galactoside-binding, soluble, 8 (LGALS8), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP320102 Purified recombinant protein of Homo sapiens lectin, galactoside-binding, soluble, 8 (LGALS8), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP320163 Recombinant protein of human lectin, galactoside-binding, soluble, 8 (LGALS8), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.