OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GnRH (GNRH1) (NM_001083111) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP319734
Recombinant protein of human gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA349380 Rabbit Polyclonal Anti-GNRH1 Antibody
100 ul
$205.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "GnRH or NM_001083111"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC219734 protein sequence
Red=Cloning site Green=Tags(s)

MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRS
PLRDLKGALESLIEEETGQKKI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 7.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001076580
Locus ID 2796
UniProt ID P01148
Cytogenetics 8p21.2
RefSeq Size 1297
RefSeq ORF 276
Synonyms GNRH; GRH; LHRH; LNRH
Summary This gene encodes a preproprotein that is proteolytically processed to generate a peptide that is a member of the gonadotropin-releasing hormone (GnRH) family of peptides. Alternative splicing results in multiple transcript variants, at least one of which is secreted and then cleaved to generate gonadoliberin-1 and GnRH-associated peptide 1. Gonadoliberin-1 stimulates the release of luteinizing and follicle stimulating hormones, which are important for reproduction. Mutations in this gene are associated with hypogonadotropic hypogonadism. provided by RefSeq, Nov 2015
Protein Categories Endocrine and metabolic diseases, Secreated Proteins
Protein Families Druggable Genome, Secreted Protein
Protein Pathways GnRH signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GnRH" proteins (5)
SKU Description Size Price
PH319734 GNRH1 MS Standard C13 and N15-labeled recombinant protein (NP_001076580) 10 ug
$3,360.00
LC421206 Lyophilized GNRH1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424503 Lyophilized GNRH1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY421206 Transient overexpression lysate of gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY424503 Transient overexpression lysate of gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 1 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products