GnRH (GNRH1) (NM_001083111) Human Recombinant Protein
SKU
TP319734
Recombinant protein of human gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 2, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC219734 protein sequence
Red=Cloning site Green=Tags(s) MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRS PLRDLKGALESLIEEETGQKKI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 7.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001076580 |
Locus ID | 2796 |
UniProt ID | P01148 |
Cytogenetics | 8p21.2 |
RefSeq Size | 1297 |
RefSeq ORF | 276 |
Synonyms | GNRH; GRH; LHRH; LNRH |
Summary | This gene encodes a preproprotein that is proteolytically processed to generate a peptide that is a member of the gonadotropin-releasing hormone (GnRH) family of peptides. Alternative splicing results in multiple transcript variants, at least one of which is secreted and then cleaved to generate gonadoliberin-1 and GnRH-associated peptide 1. Gonadoliberin-1 stimulates the release of luteinizing and follicle stimulating hormones, which are important for reproduction. Mutations in this gene are associated with hypogonadotropic hypogonadism. [provided by RefSeq, Nov 2015] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | GnRH signaling pathway |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH319734 | GNRH1 MS Standard C13 and N15-labeled recombinant protein (NP_001076580) | 10 ug |
$3,255.00
|
|
LC421206 | GNRH1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC424503 | GNRH1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY421206 | Transient overexpression lysate of gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 2 | 100 ug |
$436.00
|
|
LY424503 | Transient overexpression lysate of gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 1 | 100 ug |
$436.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.