GnRH (GNRH1) (NM_001083111) Human Mass Spec Standard

SKU PH319734

GNRH1 MS Standard C13 and N15-labeled recombinant protein (NP_001076580)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC219734]
• Predicted MW: 10.4 kDa
• Protein Sequence:
  Protein Sequence

  >RC219734 protein sequence; Red=Cloning site Green=Tags(s); ; MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRS; PLRDLKGALESLIEEETGQKKI; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001076580
• RefSeq Size: 1297
• RefSeq ORF: 276
• Synonyms: GNRH; GRH; LHRH; LNRH
• Locus ID: 2796
• UniProt ID: P01148
• Cytogenetics: 8p21.2
• Summary: This gene encodes a preproprotein that is proteolytically processed to generate a peptide that is a member of the gonadotropin-releasing hormone (GnRH) family of peptides. Alternative splicing results in multiple transcript variants, at least one of which is secreted and then cleaved to generate gonadoliberin-1 and GnRH-associated peptide 1. Gonadoliberin-1 stimulates the release of luteinizing and follicle stimulating hormones, which are important for reproduction. Mutations in this gene are associated with hypogonadotropic hypogonadism. [provided by RefSeq, Nov 2015]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: GnRH signaling pathway