BTBD9 (NM_152733) Human Recombinant Protein

SKU
TP319508
Recombinant protein of human BTB (POZ) domain containing 9 (BTBD9), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC219508 representing NM_152733
Red=Cloning site Green=Tags(s)

MRESQPEAEIPLQDTTAEAFTMLLKYIYTGRATLTDEKEEVLLDFLSLAHKYGFPELEDSTSEYLCTILN
IQNVCMTFDVASLYSLPKLTCMCCMFMDRNAQEVLSSEGFLSLSKTALLNIVLRDSFAAPEKDIFLALLN
WCKHNSKENHAEIMQAVRLPLMSLTELLNVVRPSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENIA
TMKYGAQVVKGELKSALLDGDTQNYDLDHGFSRHPIDDDCRSGIEIKLGQPSVINHIRILLWDRDSRSYS
YFIEVSMDELDWVRVIDHSQYLCRSWQKLYFPARVCRYIRIVGTHNTVNKIFHIVAFECMFTNKTFTLEK
GLIVPMENVATIADCASVIEGVSRSRNALLNGDTKNYDWDSGYTCHQLGSGAIVVQLAQPYMIGSIRLLL
WDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVGTHNTANEVFHCVHFECPE
QQSSQKEENSEESGTGDTSLAGQQLDSHALRAPSGSSLPSSPGSNSRSPNRQHQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 61.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_689946
Locus ID 114781
UniProt ID Q96Q07
Cytogenetics 6p21.2
RefSeq Size 1980
RefSeq ORF 1632
Synonyms dJ322I12.1
Summary This locus encodes a BTB/POZ domain-containing protein. This domain is known to be involved in protein-protein interactions. Polymorphisms at this locus have been reported to be associated with susceptibility to Restless Legs Syndrome and may also be associated with Tourette Syndrome. Alternatively spliced transcript variants have been described. [provided by RefSeq, Aug 2011]
Write Your Own Review
You're reviewing:BTBD9 (NM_152733) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH319508 BTBD9 MS Standard C13 and N15-labeled recombinant protein (NP_689946) 10 ug
$3,255.00
LC407331 BTBD9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409409 BTBD9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420380 BTBD9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407331 Transient overexpression lysate of BTB (POZ) domain containing 9 (BTBD9), transcript variant 3 100 ug
$665.00
LY409409 Transient overexpression lysate of BTB (POZ) domain containing 9 (BTBD9), transcript variant 1 100 ug
$665.00
LY420380 Transient overexpression lysate of BTB (POZ) domain containing 9 (BTBD9), transcript variant 2 100 ug
$665.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.