BTBD9 (NM_152733) Human Recombinant Protein
SKU
TP319508
Recombinant protein of human BTB (POZ) domain containing 9 (BTBD9), transcript variant 3, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC219508 representing NM_152733
Red=Cloning site Green=Tags(s) MRESQPEAEIPLQDTTAEAFTMLLKYIYTGRATLTDEKEEVLLDFLSLAHKYGFPELEDSTSEYLCTILN IQNVCMTFDVASLYSLPKLTCMCCMFMDRNAQEVLSSEGFLSLSKTALLNIVLRDSFAAPEKDIFLALLN WCKHNSKENHAEIMQAVRLPLMSLTELLNVVRPSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENIA TMKYGAQVVKGELKSALLDGDTQNYDLDHGFSRHPIDDDCRSGIEIKLGQPSVINHIRILLWDRDSRSYS YFIEVSMDELDWVRVIDHSQYLCRSWQKLYFPARVCRYIRIVGTHNTVNKIFHIVAFECMFTNKTFTLEK GLIVPMENVATIADCASVIEGVSRSRNALLNGDTKNYDWDSGYTCHQLGSGAIVVQLAQPYMIGSIRLLL WDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVGTHNTANEVFHCVHFECPE QQSSQKEENSEESGTGDTSLAGQQLDSHALRAPSGSSLPSSPGSNSRSPNRQHQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 61.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_689946 |
Locus ID | 114781 |
UniProt ID | Q96Q07 |
Cytogenetics | 6p21.2 |
RefSeq Size | 1980 |
RefSeq ORF | 1632 |
Synonyms | dJ322I12.1 |
Summary | This locus encodes a BTB/POZ domain-containing protein. This domain is known to be involved in protein-protein interactions. Polymorphisms at this locus have been reported to be associated with susceptibility to Restless Legs Syndrome and may also be associated with Tourette Syndrome. Alternatively spliced transcript variants have been described. [provided by RefSeq, Aug 2011] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH319508 | BTBD9 MS Standard C13 and N15-labeled recombinant protein (NP_689946) | 10 ug |
$3,255.00
|
|
LC407331 | BTBD9 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC409409 | BTBD9 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC420380 | BTBD9 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY407331 | Transient overexpression lysate of BTB (POZ) domain containing 9 (BTBD9), transcript variant 3 | 100 ug |
$665.00
|
|
LY409409 | Transient overexpression lysate of BTB (POZ) domain containing 9 (BTBD9), transcript variant 1 | 100 ug |
$665.00
|
|
LY420380 | Transient overexpression lysate of BTB (POZ) domain containing 9 (BTBD9), transcript variant 2 | 100 ug |
$665.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.