BTBD9 (NM_152733) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC219508] |
Predicted MW | 61.4 kDa |
Protein Sequence |
Protein Sequence
>RC219508 representing NM_152733
Red=Cloning site Green=Tags(s) MRESQPEAEIPLQDTTAEAFTMLLKYIYTGRATLTDEKEEVLLDFLSLAHKYGFPELEDSTSEYLCTILN IQNVCMTFDVASLYSLPKLTCMCCMFMDRNAQEVLSSEGFLSLSKTALLNIVLRDSFAAPEKDIFLALLN WCKHNSKENHAEIMQAVRLPLMSLTELLNVVRPSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENIA TMKYGAQVVKGELKSALLDGDTQNYDLDHGFSRHPIDDDCRSGIEIKLGQPSVINHIRILLWDRDSRSYS YFIEVSMDELDWVRVIDHSQYLCRSWQKLYFPARVCRYIRIVGTHNTVNKIFHIVAFECMFTNKTFTLEK GLIVPMENVATIADCASVIEGVSRSRNALLNGDTKNYDWDSGYTCHQLGSGAIVVQLAQPYMIGSIRLLL WDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVGTHNTANEVFHCVHFECPE QQSSQKEENSEESGTGDTSLAGQQLDSHALRAPSGSSLPSSPGSNSRSPNRQHQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_689946 |
RefSeq Size | 1980 |
RefSeq ORF | 1632 |
Synonyms | dJ322I12.1 |
Locus ID | 114781 |
UniProt ID | Q96Q07 |
Cytogenetics | 6p21.2 |
Summary | This locus encodes a BTB/POZ domain-containing protein. This domain is known to be involved in protein-protein interactions. Polymorphisms at this locus have been reported to be associated with susceptibility to Restless Legs Syndrome and may also be associated with Tourette Syndrome. Alternatively spliced transcript variants have been described. [provided by RefSeq, Aug 2011] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC407331 | BTBD9 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC409409 | BTBD9 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC420380 | BTBD9 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY407331 | Transient overexpression lysate of BTB (POZ) domain containing 9 (BTBD9), transcript variant 3 | 100 ug |
$665.00
|
|
LY409409 | Transient overexpression lysate of BTB (POZ) domain containing 9 (BTBD9), transcript variant 1 | 100 ug |
$665.00
|
|
LY420380 | Transient overexpression lysate of BTB (POZ) domain containing 9 (BTBD9), transcript variant 2 | 100 ug |
$665.00
|
|
TP319508 | Recombinant protein of human BTB (POZ) domain containing 9 (BTBD9), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.