BTBD9 (NM_152733) Human Mass Spec Standard

SKU
PH319508
BTBD9 MS Standard C13 and N15-labeled recombinant protein (NP_689946)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219508]
Predicted MW 61.4 kDa
Protein Sequence
Protein Sequence
>RC219508 representing NM_152733
Red=Cloning site Green=Tags(s)

MRESQPEAEIPLQDTTAEAFTMLLKYIYTGRATLTDEKEEVLLDFLSLAHKYGFPELEDSTSEYLCTILN
IQNVCMTFDVASLYSLPKLTCMCCMFMDRNAQEVLSSEGFLSLSKTALLNIVLRDSFAAPEKDIFLALLN
WCKHNSKENHAEIMQAVRLPLMSLTELLNVVRPSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENIA
TMKYGAQVVKGELKSALLDGDTQNYDLDHGFSRHPIDDDCRSGIEIKLGQPSVINHIRILLWDRDSRSYS
YFIEVSMDELDWVRVIDHSQYLCRSWQKLYFPARVCRYIRIVGTHNTVNKIFHIVAFECMFTNKTFTLEK
GLIVPMENVATIADCASVIEGVSRSRNALLNGDTKNYDWDSGYTCHQLGSGAIVVQLAQPYMIGSIRLLL
WDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVGTHNTANEVFHCVHFECPE
QQSSQKEENSEESGTGDTSLAGQQLDSHALRAPSGSSLPSSPGSNSRSPNRQHQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689946
RefSeq Size 1980
RefSeq ORF 1632
Synonyms dJ322I12.1
Locus ID 114781
UniProt ID Q96Q07
Cytogenetics 6p21.2
Summary This locus encodes a BTB/POZ domain-containing protein. This domain is known to be involved in protein-protein interactions. Polymorphisms at this locus have been reported to be associated with susceptibility to Restless Legs Syndrome and may also be associated with Tourette Syndrome. Alternatively spliced transcript variants have been described. [provided by RefSeq, Aug 2011]
Write Your Own Review
You're reviewing:BTBD9 (NM_152733) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC407331 BTBD9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409409 BTBD9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420380 BTBD9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407331 Transient overexpression lysate of BTB (POZ) domain containing 9 (BTBD9), transcript variant 3 100 ug
$665.00
LY409409 Transient overexpression lysate of BTB (POZ) domain containing 9 (BTBD9), transcript variant 1 100 ug
$665.00
LY420380 Transient overexpression lysate of BTB (POZ) domain containing 9 (BTBD9), transcript variant 2 100 ug
$665.00
TP319508 Recombinant protein of human BTB (POZ) domain containing 9 (BTBD9), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.