IL36 alpha (IL36A) (NM_014440) Human Recombinant Protein

SKU
TP319328
Recombinant protein of human interleukin 1 family, member 6 (epsilon) (IL1F6), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>Peptide sequence encoded by RC219328
Blue=ORF Red=Cloning site Green=Tag(s)

MEKALKIDTPQRGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNG
LNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPL
ILTQELGKANTTDFGLTMLF

myc-FLAG tag

Recombinant protein using RC219328 also available, TP319328M
Tag C-Myc/DDK
Predicted MW 17.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_055255
Locus ID 27179
UniProt ID Q9UHA7
Cytogenetics 2q14.1
RefSeq Size 477
RefSeq ORF 474
Synonyms FIL1; FIL1(EPSILON); FIL1E; IL-1F6; IL1(EPSILON); IL1F6
Summary The protein encoded by this gene is a cytokine that can activate NF-kappa-B and MAPK signaling pathways to generate an inflammatory response. The encoded protein functions primarily in skin and demonstrates increased expression in psoriasis. In addition, decreased expression of this gene has been linked to a poor prognosis in both hepatocellular carcinoma and colorectal cancer patients. [provided by RefSeq, Nov 2015]
Protein Families Druggable Genome, Secreted Protein
Write Your Own Review
You're reviewing:IL36 alpha (IL36A) (NM_014440) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH319328 IL1F6 MS Standard C13 and N15-labeled recombinant protein (NP_055255) 10 ug
$3,255.00
LC415288 IL36A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415288 Transient overexpression lysate of interleukin 1 family, member 6 (epsilon) (IL1F6) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.