IL36 alpha (IL36A) (NM_014440) Human Mass Spec Standard

SKU
PH319328
IL1F6 MS Standard C13 and N15-labeled recombinant protein (NP_055255)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219328]
Predicted MW 17.7 kDa
Protein Sequence
Protein Sequence
>Peptide sequence encoded by RC219328
Blue=ORF Red=Cloning site Green=Tag(s)

MEKALKIDTPQRGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNG
LNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPL
ILTQELGKANTTDFGLTMLF

myc-FLAG tag

Recombinant protein using RC219328 also available, TP319328M
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055255
RefSeq Size 477
RefSeq ORF 474
Synonyms FIL1; FIL1(EPSILON); FIL1E; IL-1F6; IL1(EPSILON); IL1F6
Locus ID 27179
UniProt ID Q9UHA7
Cytogenetics 2q14.1
Summary The protein encoded by this gene is a cytokine that can activate NF-kappa-B and MAPK signaling pathways to generate an inflammatory response. The encoded protein functions primarily in skin and demonstrates increased expression in psoriasis. In addition, decreased expression of this gene has been linked to a poor prognosis in both hepatocellular carcinoma and colorectal cancer patients. [provided by RefSeq, Nov 2015]
Protein Families Druggable Genome, Secreted Protein
Write Your Own Review
You're reviewing:IL36 alpha (IL36A) (NM_014440) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415288 IL36A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415288 Transient overexpression lysate of interleukin 1 family, member 6 (epsilon) (IL1F6) 100 ug
$436.00
TP319328 Recombinant protein of human interleukin 1 family, member 6 (epsilon) (IL1F6), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.