HROB (NM_024032) Human Recombinant Protein

SKU
TP319307
Recombinant protein of human chromosome 17 open reading frame 53 (C17orf53), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC219307 representing NM_024032
Red=Cloning site Green=Tags(s)

MACSLQKLFAVEEEFEDEDFLSAVEDAENRFTGSLPVNAGRLRPVSSRPQETVQAQSSRLLLLHPTAPSE
ALGLPDLDLCLPASSTPSADSRPSCIGAAPLRPVSTSSSWIGNQRRVTVTEVLRETARPQSSALHPLLTF
ESQQQQVGGFEGPEQDEFDKVLASMELEEPGMELECGVSSEAIPILPAQQREGSVLAKKARVVDLSGSCQ
KGPVPAIHKAGIMSAQDESLDPVIQCRTPRPPLRPGAVGHLPVPTALTVPTQQLHWEVCPQRSPVQALQP
LQAARGTIQSSPQNRFPCQPFQSPSSWLSGKAHLPRPRTPNSSCSTPSRTSSGLFPRIPLQPQAPVSSIG
SPVGTPKGPQGALQTPIVTNHLVQLVTAASRTPQQPTHPSTRAKTRRFPGPAGILPHQQSGRSLEDIMVS
APQTPTHGALAKFQTEIVASSQASVEEDFGRGPWLTMKSTLGLDERDPSCFLCTYSIVMVLRKQAALKQL
PRNKVPNMAVMIKSLTRSTMDASVVFKDPTGEMQGTVHRLLLETCQNELKPGSVLLLKQIGVFSPSLRNH
YLNVTPNNLVHIYSPDSGDGSFLKPSQPFPKDSGSFQHDVAAKPEEGFRTAQNLEAEASPEEELPEADDL
DGLLSELPEDFFCGTSS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 69.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_076937
Locus ID 78995
UniProt ID Q8N3J3
Cytogenetics 17q21.31
RefSeq Size 2727
RefSeq ORF 1941
Synonyms C17orf53; MCM8IP
Summary DNA-binding protein involved in homologous recombination that acts by recruiting the MCM8-MCM9 helicase complex to sites of DNA damage to promote DNA repair synthesis.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:HROB (NM_024032) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH319307 C17orf53 MS Standard C13 and N15-labeled recombinant protein (NP_076937) 10 ug
$3,255.00
LC411409 C17orf53 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433389 C17orf53 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411409 Transient overexpression lysate of chromosome 17 open reading frame 53 (C17orf53), transcript variant 1 100 ug
$665.00
LY433389 Transient overexpression lysate of chromosome 17 open reading frame 53 (C17orf53), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.