HROB (NM_024032) Human Mass Spec Standard

SKU
PH319307
C17orf53 MS Standard C13 and N15-labeled recombinant protein (NP_076937)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219307]
Predicted MW 69.6 kDa
Protein Sequence
Protein Sequence
>RC219307 representing NM_024032
Red=Cloning site Green=Tags(s)

MACSLQKLFAVEEEFEDEDFLSAVEDAENRFTGSLPVNAGRLRPVSSRPQETVQAQSSRLLLLHPTAPSE
ALGLPDLDLCLPASSTPSADSRPSCIGAAPLRPVSTSSSWIGNQRRVTVTEVLRETARPQSSALHPLLTF
ESQQQQVGGFEGPEQDEFDKVLASMELEEPGMELECGVSSEAIPILPAQQREGSVLAKKARVVDLSGSCQ
KGPVPAIHKAGIMSAQDESLDPVIQCRTPRPPLRPGAVGHLPVPTALTVPTQQLHWEVCPQRSPVQALQP
LQAARGTIQSSPQNRFPCQPFQSPSSWLSGKAHLPRPRTPNSSCSTPSRTSSGLFPRIPLQPQAPVSSIG
SPVGTPKGPQGALQTPIVTNHLVQLVTAASRTPQQPTHPSTRAKTRRFPGPAGILPHQQSGRSLEDIMVS
APQTPTHGALAKFQTEIVASSQASVEEDFGRGPWLTMKSTLGLDERDPSCFLCTYSIVMVLRKQAALKQL
PRNKVPNMAVMIKSLTRSTMDASVVFKDPTGEMQGTVHRLLLETCQNELKPGSVLLLKQIGVFSPSLRNH
YLNVTPNNLVHIYSPDSGDGSFLKPSQPFPKDSGSFQHDVAAKPEEGFRTAQNLEAEASPEEELPEADDL
DGLLSELPEDFFCGTSS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_076937
RefSeq Size 2727
RefSeq ORF 1941
Synonyms C17orf53; MCM8IP
Locus ID 78995
UniProt ID Q8N3J3
Cytogenetics 17q21.31
Summary DNA-binding protein involved in homologous recombination that acts by recruiting the MCM8-MCM9 helicase complex to sites of DNA damage to promote DNA repair synthesis.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:HROB (NM_024032) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411409 C17orf53 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433389 C17orf53 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411409 Transient overexpression lysate of chromosome 17 open reading frame 53 (C17orf53), transcript variant 1 100 ug
$665.00
LY433389 Transient overexpression lysate of chromosome 17 open reading frame 53 (C17orf53), transcript variant 2 100 ug
$436.00
TP319307 Recombinant protein of human chromosome 17 open reading frame 53 (C17orf53), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.