MADCAM1 (NM_130760) Human Recombinant Protein

SKU
TP319060
Recombinant protein of human mucosal vascular addressin cell adhesion molecule 1 (MADCAM1), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC219060 representing NM_130760
Red=Cloning site Green=Tags(s)

MDFGLALLLAGLLGLLLGQSLQVKPLQVEPPEPVVAVALGASRQLTCRLACADRGASVQWRGLDTSLGAV
QSDTGRSVLTVRNASLSAAGTRVCVGSCGGRTFQHTVQLLVYAFPDQLTVSPAALVPGDPEVACTAHKVT
PVDPNALSFSLLVGGQELEGAQALGPEVQEEEEEPQGDEDVLFRVTERWRLPPLGTPVPPALYCQATMRL
PGLELSHRQAIPVLHSPTSPEPPNTTSPEPPNTTSPESPDTTSPEPPDTTSPEPPDKTSPEPAPQQGSTH
TPRSPGSTRTRRPEISQAGPTQGEVIPTGSSKPAGDQLPAALWTSSAVLGLLLLALPTYHLWKRCRHLAE
DDTHPPASLRLLPQVSAWAGLRGTGQVGISPS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 38.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_570116
Locus ID 8174
UniProt ID Q13477
Cytogenetics 19p13.3
RefSeq Size 1546
RefSeq ORF 1146
Synonyms MACAM1
Summary The protein encoded by this gene is an endothelial cell adhesion molecule that interacts preferentially with the leukocyte beta7 integrin LPAM-1 (alpha4beta7), L-selectin, and VLA-4 (alpha4beta1) on myeloid cells to direct leukocytes into mucosal and inflamed tissues. It is a member of the immunoglobulin family and is similar to ICAM1 and VCAM1. At least seven alternatively spliced transcripts encoding different protein isoforms have been found for this gene, but the full-length nature of some variants has not been determined. [provided by RefSeq, Jul 2008]
Protein Pathways Cell adhesion molecules (CAMs)
Write Your Own Review
You're reviewing:MADCAM1 (NM_130760) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH312381 MADCAM1 MS Standard C13 and N15-labeled recombinant protein (NP_570118) 10 ug
$3,255.00
PH319060 MADCAM1 MS Standard C13 and N15-labeled recombinant protein (NP_570116) 10 ug
$3,255.00
LC408927 MADCAM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408928 MADCAM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408927 Transient overexpression lysate of mucosal vascular addressin cell adhesion molecule 1 (MADCAM1), transcript variant 1 100 ug
$436.00
LY408928 Transient overexpression lysate of mucosal vascular addressin cell adhesion molecule 1 (MADCAM1), transcript variant 2 100 ug
$436.00
TP312381 Recombinant protein of human mucosal vascular addressin cell adhesion molecule 1 (MADCAM1), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.