MADCAM1 (NM_130762) Human Mass Spec Standard

SKU
PH312381
MADCAM1 MS Standard C13 and N15-labeled recombinant protein (NP_570118)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212381]
Predicted MW 29.3 kDa
Protein Sequence
Protein Sequence
>RC212381 representing NM_130762
Red=Cloning site Green=Tags(s)

MDFGLALLLAGLLGLLLGQSLQVKPLQVEPPEPVVAVALGASRQLTCRLACADRGASVQWRGLDTSLGAV
QSDTGRSVLTVRNASLSAAGTRVCVGSCGGRTFQHTVQLLVYAFPDQLTVSPAALVPGDPEVACTAHKVT
PVDPNALSFSLLVGGQELEGAQALGPEVQEEEEEPQGDEDVLFRVTERWRLPPLGTPVPPALYCQATMRL
PGLELSHRQAIPASKPAGDQLPAALWTSSAVLGLLLLALPTYHLWKRCRHLAEDDTHPPASLRLLPQVSA
WAGLRGTGQVGISPS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_570118
RefSeq Size 1275
RefSeq ORF 885
Synonyms MACAM1
Locus ID 8174
UniProt ID Q13477
Cytogenetics 19p13.3
Summary The protein encoded by this gene is an endothelial cell adhesion molecule that interacts preferentially with the leukocyte beta7 integrin LPAM-1 (alpha4beta7), L-selectin, and VLA-4 (alpha4beta1) on myeloid cells to direct leukocytes into mucosal and inflamed tissues. It is a member of the immunoglobulin family and is similar to ICAM1 and VCAM1. At least seven alternatively spliced transcripts encoding different protein isoforms have been found for this gene, but the full-length nature of some variants has not been determined. [provided by RefSeq, Jul 2008]
Protein Pathways Cell adhesion molecules (CAMs)
Write Your Own Review
You're reviewing:MADCAM1 (NM_130762) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH319060 MADCAM1 MS Standard C13 and N15-labeled recombinant protein (NP_570116) 10 ug
$3,255.00
LC408927 MADCAM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408928 MADCAM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408927 Transient overexpression lysate of mucosal vascular addressin cell adhesion molecule 1 (MADCAM1), transcript variant 1 100 ug
$436.00
LY408928 Transient overexpression lysate of mucosal vascular addressin cell adhesion molecule 1 (MADCAM1), transcript variant 2 100 ug
$436.00
TP312381 Recombinant protein of human mucosal vascular addressin cell adhesion molecule 1 (MADCAM1), transcript variant 2, 20 µg 20 ug
$737.00
TP319060 Recombinant protein of human mucosal vascular addressin cell adhesion molecule 1 (MADCAM1), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.