PPP1R16B (NM_015568) Human Recombinant Protein

SKU
TP318476
Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 16B (PPP1R16B), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>Peptide sequence encoded by RC218476
Blue=ORF Red=Cloning site Green=Tag(s)

MASHVDLLTELQLLEKVPTLERLRAAQKRRAQQLKKWAQYEQDLQHRKRKHERKRSTGGRRKKVSFEAS
VALLEASLRNDAEEVRYFLKNKVSPDLCNEDGLTALHQCCIDNFEEIVKLLLSHGANVNAKDNELWTPL
HAAATCGHINLVKILVQYGADLLAVNSDGNMPYDLCEDEPTLDVIETCMAYQGITQEKINEMRVAPEQQ
MIADIHCMIAAGQDLDWIDAQGATLLHIAGANGYLRAAELLLDHGVRVDVKDWDGWEPLHAAAFWGQMQ
MAELLVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELKHKHDVIMKSQLRHKSSLSRRTSSAGSRGKV
VRRASLSDRTNLYRKEYEGEAILWQRSAAEDQRTSTYNGDIRETRTDQENKDPNPRLEKPVLLSEFPTK
IPRGELDMPVENGLRAPVSAYQYALANGDVWKVHEVPDYSMAYGNPGVADATPPWSSYKEQSPQTLLEL
KRQRAAAKLLSHPFLSTHLGSSMARTGESSSEGKAPLIGGRTSPYSSNGTSVYYTVTSGDPPLLKFKAP
IEEMEEKVHGCCRIS

myc-FLAG tag

Recombinant protein using RC218476 also available, TP318476
Tag C-Myc/DDK
Predicted MW 63.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_056383
Locus ID 26051
UniProt ID Q96T49
Cytogenetics 20q11.23
RefSeq Size 6251
RefSeq ORF 1701
Synonyms ANKRD4; TIMAP
Summary The protein encoded by this gene is membrane-associated and contains five ankyrin repeats, a protein phosphatase-1-interacting domain, and a carboxy-terminal CAAX box domain. Synthesis of the encoded protein is inhibited by transforming growth factor beta-1. The protein may bind to the membrane through its CAAX box domain and may act as a signaling molecule through interaction with protein phosphatase-1. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein. [provided by RefSeq, Sep 2015]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:PPP1R16B (NM_015568) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH318476 PPP1R16B MS Standard C13 and N15-labeled recombinant protein (NP_056383) 10 ug
$3,255.00
LC402449 PPP1R16B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433229 PPP1R16B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402449 Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 16B (PPP1R16B) 100 ug
$665.00
LY433229 Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 16B (PPP1R16B), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.