PPP1R16B (NM_015568) Human Mass Spec Standard

SKU
PH318476
PPP1R16B MS Standard C13 and N15-labeled recombinant protein (NP_056383)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC218476]
Predicted MW 63.6 kDa
Protein Sequence
Protein Sequence
>Peptide sequence encoded by RC218476
Blue=ORF Red=Cloning site Green=Tag(s)

MASHVDLLTELQLLEKVPTLERLRAAQKRRAQQLKKWAQYEQDLQHRKRKHERKRSTGGRRKKVSFEAS
VALLEASLRNDAEEVRYFLKNKVSPDLCNEDGLTALHQCCIDNFEEIVKLLLSHGANVNAKDNELWTPL
HAAATCGHINLVKILVQYGADLLAVNSDGNMPYDLCEDEPTLDVIETCMAYQGITQEKINEMRVAPEQQ
MIADIHCMIAAGQDLDWIDAQGATLLHIAGANGYLRAAELLLDHGVRVDVKDWDGWEPLHAAAFWGQMQ
MAELLVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELKHKHDVIMKSQLRHKSSLSRRTSSAGSRGKV
VRRASLSDRTNLYRKEYEGEAILWQRSAAEDQRTSTYNGDIRETRTDQENKDPNPRLEKPVLLSEFPTK
IPRGELDMPVENGLRAPVSAYQYALANGDVWKVHEVPDYSMAYGNPGVADATPPWSSYKEQSPQTLLEL
KRQRAAAKLLSHPFLSTHLGSSMARTGESSSEGKAPLIGGRTSPYSSNGTSVYYTVTSGDPPLLKFKAP
IEEMEEKVHGCCRIS

myc-FLAG tag

Recombinant protein using RC218476 also available, TP318476
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056383
RefSeq Size 6251
RefSeq ORF 1701
Synonyms ANKRD4; TIMAP
Locus ID 26051
UniProt ID Q96T49
Cytogenetics 20q11.23
Summary The protein encoded by this gene is membrane-associated and contains five ankyrin repeats, a protein phosphatase-1-interacting domain, and a carboxy-terminal CAAX box domain. Synthesis of the encoded protein is inhibited by transforming growth factor beta-1. The protein may bind to the membrane through its CAAX box domain and may act as a signaling molecule through interaction with protein phosphatase-1. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein. [provided by RefSeq, Sep 2015]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:PPP1R16B (NM_015568) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402449 PPP1R16B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433229 PPP1R16B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402449 Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 16B (PPP1R16B) 100 ug
$665.00
LY433229 Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 16B (PPP1R16B), transcript variant 2 100 ug
$436.00
TP318476 Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 16B (PPP1R16B), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.