HAO2 (NM_001005783) Human Recombinant Protein

SKU
TP318416
Purified recombinant protein of Homo sapiens hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC218416 protein sequence
Red=Cloning site Green=Tags(s)

MSLVCLTDFQAHAREQLSKSTRDFIEGGADDSITRDDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEIS
APICIAPTGFHCLVWPDGEMSTARAAQAAGICYITSTFASCSLEDIVIAAPEGLRWFQLYVHPDLQLNKQ
LIQRVESLGFKALVITLDTPVCGNRRHDIRNQLRRNLTLTDLQSPKKGNAIPYFQMTPISTSLCWNDLSW
FQSITRLPIILKGILTKEDAELAVKHNVQGIIVSNHGGRQLDEVLASIDALTEVVAAVKGKIEVYLDGGV
RTGNDVLKALALGAKCIFLGRPILWGLACKGEHGVKEVLNILTNEFHTSMALTGCRSVAEINRNLVQFSR
L

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 38.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001005783
Locus ID 51179
UniProt ID Q9NYQ3
Cytogenetics 1p12
RefSeq Size 1708
RefSeq ORF 1053
Synonyms GIG16; HAOX2
Summary This gene is one of three related genes that have 2-hydroxyacid oxidase activity. The encoded protein localizes to the peroxisome has the highest activity toward the substrate 2-hydroxypalmitate. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
Protein Pathways Glyoxylate and dicarboxylate metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:HAO2 (NM_001005783) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH305051 HAO2 MS Standard C13 and N15-labeled recombinant protein (NP_057611) 10 ug
$3,255.00
PH318416 HAO2 MS Standard C13 and N15-labeled recombinant protein (NP_001005783) 10 ug
$3,255.00
LC413922 HAO2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423655 HAO2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413922 Transient overexpression lysate of hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 1 100 ug
$436.00
LY423655 Transient overexpression lysate of hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 2 100 ug
$436.00
TP305051 Recombinant protein of human hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.