HAO2 (NM_001005783) Human Mass Spec Standard

SKU
PH318416
HAO2 MS Standard C13 and N15-labeled recombinant protein (NP_001005783)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC218416]
Predicted MW 38.8 kDa
Protein Sequence
Protein Sequence
>RC218416 protein sequence
Red=Cloning site Green=Tags(s)

MSLVCLTDFQAHAREQLSKSTRDFIEGGADDSITRDDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEIS
APICIAPTGFHCLVWPDGEMSTARAAQAAGICYITSTFASCSLEDIVIAAPEGLRWFQLYVHPDLQLNKQ
LIQRVESLGFKALVITLDTPVCGNRRHDIRNQLRRNLTLTDLQSPKKGNAIPYFQMTPISTSLCWNDLSW
FQSITRLPIILKGILTKEDAELAVKHNVQGIIVSNHGGRQLDEVLASIDALTEVVAAVKGKIEVYLDGGV
RTGNDVLKALALGAKCIFLGRPILWGLACKGEHGVKEVLNILTNEFHTSMALTGCRSVAEINRNLVQFSR
L

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001005783
RefSeq Size 1708
RefSeq ORF 1053
Synonyms GIG16; HAOX2
Locus ID 51179
UniProt ID Q9NYQ3
Cytogenetics 1p12
Summary This gene is one of three related genes that have 2-hydroxyacid oxidase activity. The encoded protein localizes to the peroxisome has the highest activity toward the substrate 2-hydroxypalmitate. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
Protein Pathways Glyoxylate and dicarboxylate metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:HAO2 (NM_001005783) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH305051 HAO2 MS Standard C13 and N15-labeled recombinant protein (NP_057611) 10 ug
$3,255.00
LC413922 HAO2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423655 HAO2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413922 Transient overexpression lysate of hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 1 100 ug
$436.00
LY423655 Transient overexpression lysate of hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 2 100 ug
$436.00
TP305051 Recombinant protein of human hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 1, 20 µg 20 ug
$737.00
TP318416 Purified recombinant protein of Homo sapiens hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.