C5ORF44 (TRAPPC13) (NM_001093756) Human Recombinant Protein

SKU
TP318288
Recombinant protein of human chromosome 5 open reading frame 44 (C5orf44), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC218288 representing NM_001093756
Red=Cloning site Green=Tags(s)

MEVNPPKQEHLLALKVMRLTKPTLFTNIPVTCEEKDLPGDLFNQLMRDDPSTVNGAEVLMLGEMLTLPQN
FGNIFLGETFSSYISVHNDSNQVVKDILVKADLQTSSQRLNLSASNAAVAELKPDCCIDDVIHHEVKEIG
THILVCAVSYTTQAGEKMYFRKFFKFQVLKPLDVKTKFYNAETDEVFLEAQIQNMTTSPMFMEKVSLEPS
IMYNVTELNSVSQAGECVSTFGSRAYLQPMDTRQYLYCLKPKNEFAEKAGIIKGVTVIGKLDIVWKTNLG
ERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCKITNCSERTMDLVLEMCNTNSIHWCGISG
RQLGKLHPSSSLCLALTLLSSVQGLQSISGLRLTDTFLKRTYEYDDIAQVCVVSSAIKVES

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 45.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001087225
Locus ID 80006
UniProt ID A5PLN9
Cytogenetics 5q12.3
RefSeq Size 3099
RefSeq ORF 1233
Synonyms C5orf44; SHLD3
Write Your Own Review
You're reviewing:C5ORF44 (TRAPPC13) (NM_001093756) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH318288 C5orf44 MS Standard C13 and N15-labeled recombinant protein (NP_001087225) 10 ug
$3,255.00
LC410973 TRAPPC13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420688 TRAPPC13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420689 TRAPPC13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410973 Transient overexpression lysate of chromosome 5 open reading frame 44 (C5orf44), transcript variant 2 100 ug
$665.00
LY420688 Transient overexpression lysate of chromosome 5 open reading frame 44 (C5orf44), transcript variant 1 100 ug
$665.00
LY420689 Transient overexpression lysate of chromosome 5 open reading frame 44 (C5orf44), transcript variant 3 100 ug
$436.00
TP761014 Purified recombinant protein of Human chromosome 5 open reading frame 44 (C5orf44), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.