C5ORF44 (TRAPPC13) (NM_001093756) Human Mass Spec Standard

SKU
PH318288
C5orf44 MS Standard C13 and N15-labeled recombinant protein (NP_001087225)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC218288]
Predicted MW 45.8 kDa
Protein Sequence
Protein Sequence
>RC218288 representing NM_001093756
Red=Cloning site Green=Tags(s)

MEVNPPKQEHLLALKVMRLTKPTLFTNIPVTCEEKDLPGDLFNQLMRDDPSTVNGAEVLMLGEMLTLPQN
FGNIFLGETFSSYISVHNDSNQVVKDILVKADLQTSSQRLNLSASNAAVAELKPDCCIDDVIHHEVKEIG
THILVCAVSYTTQAGEKMYFRKFFKFQVLKPLDVKTKFYNAETDEVFLEAQIQNMTTSPMFMEKVSLEPS
IMYNVTELNSVSQAGECVSTFGSRAYLQPMDTRQYLYCLKPKNEFAEKAGIIKGVTVIGKLDIVWKTNLG
ERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCKITNCSERTMDLVLEMCNTNSIHWCGISG
RQLGKLHPSSSLCLALTLLSSVQGLQSISGLRLTDTFLKRTYEYDDIAQVCVVSSAIKVES

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001087225
RefSeq Size 3099
RefSeq ORF 1233
Synonyms C5orf44; SHLD3
Locus ID 80006
UniProt ID A5PLN9
Cytogenetics 5q12.3
Write Your Own Review
You're reviewing:C5ORF44 (TRAPPC13) (NM_001093756) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410973 TRAPPC13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420688 TRAPPC13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420689 TRAPPC13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410973 Transient overexpression lysate of chromosome 5 open reading frame 44 (C5orf44), transcript variant 2 100 ug
$665.00
LY420688 Transient overexpression lysate of chromosome 5 open reading frame 44 (C5orf44), transcript variant 1 100 ug
$665.00
LY420689 Transient overexpression lysate of chromosome 5 open reading frame 44 (C5orf44), transcript variant 3 100 ug
$436.00
TP318288 Recombinant protein of human chromosome 5 open reading frame 44 (C5orf44), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP761014 Purified recombinant protein of Human chromosome 5 open reading frame 44 (C5orf44), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.