METTL9 (NM_001077180) Human Recombinant Protein

SKU
TP318283
Recombinant protein of human methyltransferase like 9 (METTL9), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC218283 protein sequence
Red=Cloning site Green=Tags(s)

MRLLAGWLCLSLASVWLARRMWTLRSPLTRSLYVNMTSGPGGPAAAAGGRKENHQWYVCNREKLCESLQA
VFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLKI
NPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLN
LLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVENVGGKWEKPSEILEIKGQNWEEQVNSLPEVF
RKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVLKPV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 36.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001070648
Locus ID 51108
UniProt ID Q9H1A3
Cytogenetics 16p12.2
RefSeq Size 3264
RefSeq ORF 954
Synonyms CGI-81; DREV; DREV1; PAP1
Summary Protein-histidine N-methyltransferase that specifically catalyzes 1-methylhistidine (pros-methylhistidine) methylation of target proteins (PubMed:33563959). Mediates methylation of proteins with a His-x-His (HxH) motif (where 'x' is preferably a small amino acid) (PubMed:33563959). Catalyzes methylation of target proteins such as S100A9, NDUFB3, SLC39A5, SLC39A7, ARMC6 and DNAJB12; 1-methylhistidine modification may affect the binding of zinc and other metals to its target proteins (PubMed:33563959). Constitutes the main methyltransferase for the 1-methylhistidine modification in cell (PubMed:33563959).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:METTL9 (NM_001077180) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300028 METTL9 MS Standard C13 and N15-labeled recombinant protein (NP_057109) 10 ug
$3,255.00
PH318283 METTL9 MS Standard C13 and N15-labeled recombinant protein (NP_001070648) 10 ug
$3,255.00
LC414244 METTL9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421369 METTL9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414244 Transient overexpression lysate of methyltransferase like 9 (METTL9), transcript variant 1 100 ug
$436.00
LY421369 Transient overexpression lysate of methyltransferase like 9 (METTL9), transcript variant 2 100 ug
$436.00
TP300028 Recombinant protein of human methyltransferase like 9 (METTL9), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.