OriGene Logo

METTL9 (NM_016025) Human Mass Spec Standard

Be the first to review this product
SKU
PH300028
METTL9 MS Standard C13 and N15-labeled recombinant protein (NP_057109)
Size:
10 ug
  $3,255.00
3 Weeks*
Size
Bulk/Customize

Frequently Bought Together (2)

TA389635 METTL9 Rabbit pAb 100 ul
$410.00
LY414244 Transient overexpression lysate of methyltransferase like 9 (METTL9), transcript variant 1 100 ug
$436.00

Other products for "METTL9 or NM_016025"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200028
Predicted MW 32.4 kDa
Protein Sequence
Protein Sequence
>Peptide sequence encoded by RC200028
Blue=ORF Red=Cloning site Green=Tag(s)

MTSGPGGPAAAAGGRKENHQWYVCNREKLCESLQAVFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFV
SSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLKINPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYAT
ELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVL
PFHPYVENVGGKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDA
VFVLKPV
myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057109
RefSeq Size 3267
RefSeq ORF 849
Synonyms CGI-81; DREV; DREV1; PAP1
Locus ID 51108
UniProt ID Q9H1A3
Cytogenetics 16p12.2
Summary Protein-histidine N-methyltransferase that specifically catalyzes 1-methylhistidine (pros-methylhistidine) methylation of target proteins (PubMed:33563959). Mediates methylation of proteins with a His-x-His (HxH) motif (where 'x' is preferably a small amino acid) (PubMed:33563959). Catalyzes methylation of target proteins such as S100A9, NDUFB3, SLC39A5, SLC39A7, ARMC6 and DNAJB12; 1-methylhistidine modification may affect the binding of zinc and other metals to its target proteins (PubMed:33563959). Constitutes the main methyltransferase for the 1-methylhistidine modification in cell (PubMed:33563959).[UniProtKB/Swiss-Prot Function]
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "72055" proteins (7)
SKU Description Size Price
PH318283 METTL9 MS Standard C13 and N15-labeled recombinant protein (NP_001070648) 10 ug
$3,255.00
LC414244 METTL9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421369 METTL9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414244 Transient overexpression lysate of methyltransferase like 9 (METTL9), transcript variant 1 100 ug
$436.00
LY421369 Transient overexpression lysate of methyltransferase like 9 (METTL9), transcript variant 2 100 ug
$436.00
TP300028 Recombinant protein of human methyltransferase like 9 (METTL9), transcript variant 1, 20 µg 20 ug
$737.00
TP318283 Recombinant protein of human methyltransferase like 9 (METTL9), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.