PKI alpha (PKIA) (NM_006823) Human Recombinant Protein

SKU TP318237

Recombinant protein of human protein kinase (cAMP-dependent, catalytic) inhibitor alpha (PKIA), transcript variant 6, 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC218237 protein sequence; Red=Cloning site Green=Tags(s); ; MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSSTEQSGEAQGE; AAKSES; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 7.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_006814
• Locus ID: 5569
• UniProt ID: P61925
• Cytogenetics: 8q21.13
• RefSeq Size: 4215
• RefSeq ORF: 228
• Synonyms: PRKACN1
• Summary: The protein encoded by this gene is a member of the cAMP-dependent protein kinase (PKA) inhibitor family. This protein was demonstrated to interact with and inhibit the activities of both C alpha and C beta catalytic subunits of the PKA. Alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome