PKI alpha (PKIA) (NM_006823) Human Mass Spec Standard

SKU PH318237

PKIA MS Standard C13 and N15-labeled recombinant protein (NP_006814)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC218237]
• Predicted MW: 8 kDa
• Protein Sequence:
  Protein Sequence

  >RC218237 protein sequence; Red=Cloning site Green=Tags(s); ; MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSSTEQSGEAQGE; AAKSES; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_006814
• RefSeq Size: 4215
• RefSeq ORF: 228
• Synonyms: PRKACN1
• Locus ID: 5569
• UniProt ID: P61925
• Cytogenetics: 8q21.13
• Summary: The protein encoded by this gene is a member of the cAMP-dependent protein kinase (PKA) inhibitor family. This protein was demonstrated to interact with and inhibit the activities of both C alpha and C beta catalytic subunits of the PKA. Alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome