Estrogen Related Receptor gamma (ESRRG) (NM_001438) Human Recombinant Protein

SKU
TP318233
Recombinant protein of human estrogen-related receptor gamma (ESRRG), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC218233 representing NM_001438
Red=Cloning site Green=Tags(s)

MDSVELCLPESFSLHYEEELPCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSS
TMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHY
GVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKY
KRRIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVII
GWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAIL
QLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMT
LPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 51.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001429
Locus ID 2104
UniProt ID P62508
Cytogenetics 1q41
RefSeq Size 5253
RefSeq ORF 1374
Synonyms ERR-gamma; ERR3; ERRg; ERRgamma; NR3B3
Summary This gene encodes a member of the estrogen receptor-related receptor (ESRR) family, which belongs to the nuclear hormone receptor superfamily. All members of the ESRR family share an almost identical DNA binding domain, which is composed of two C4-type zinc finger motifs. The ESRR members are orphan nuclear receptors; they bind to the estrogen response element and steroidogenic factor 1 response element, and activate genes controlled by both response elements in the absence of any ligands. The ESRR family is closely related to the estrogen receptor (ER) family. They share target genes, co-regulators and promoters, and by targeting the same set of genes, the ESRRs seem to interfere with the ER-mediated estrogen response in various ways. It has been reported that the family member encoded by this gene functions as a transcriptional activator of DNA cytosine-5-methyltransferases 1 (Dnmt1) expression by direct binding to its response elements in the DNMT1 promoters, modulates cell proliferation and estrogen signaling in breast cancer, and negatively regulates bone morphogenetic protein 2-induced osteoblast differentiation and bone formation. Multiple alternatively spliced transcript variants have been identified, which mainly differ at the 5' end and some of which encode protein isoforms differing in the N-terminal region. [provided by RefSeq, Aug 2011]
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
Write Your Own Review
You're reviewing:Estrogen Related Receptor gamma (ESRRG) (NM_001438) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH312143 ESRRG MS Standard C13 and N15-labeled recombinant protein (NP_996317) 10 ug
$3,255.00
PH314462 ESRRG MS Standard C13 and N15-labeled recombinant protein (NP_996318) 10 ug
$3,255.00
PH318233 ESRRG MS Standard C13 and N15-labeled recombinant protein (NP_001429) 10 ug
$3,255.00
PH325714 ESRRG MS Standard C13 and N15-labeled recombinant protein (NP_001127757) 10 ug
$3,255.00
LC400557 ESRRG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404215 ESRRG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400557 Transient overexpression lysate of estrogen-related receptor gamma (ESRRG), transcript variant 1 100 ug
$665.00
LY404215 Transient overexpression lysate of estrogen-related receptor gamma (ESRRG), transcript variant 2 100 ug
$665.00
TP312143 Recombinant protein of human estrogen-related receptor gamma (ESRRG), transcript variant 2, 20 µg 20 ug
$867.00
TP314462 Purified recombinant protein of Homo sapiens estrogen-related receptor gamma (ESRRG), transcript variant 3, 20 µg 20 ug
$867.00
TP325714 Purified recombinant protein of Homo sapiens estrogen-related receptor gamma (ESRRG), transcript variant 4, 20 µg 20 ug
$867.00
TP762660 Purified recombinant protein of Human estrogen-related receptor gamma (ESRRG), transcript variant 1, full length, with N-GST and C-His tag, expressed in E.coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.