Estrogen Related Receptor gamma (ESRRG) (NM_206595) Human Mass Spec Standard

SKU
PH314462
ESRRG MS Standard C13 and N15-labeled recombinant protein (NP_996318)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC214462]
Predicted MW 48.6 kDa
Protein Sequence
Protein Sequence
>RC214462 representing NM_206595
Red=Cloning site Green=Tags(s)

MSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQNGLDSPPLYPSAPILGG
SGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYS
CPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKP
YNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQS
AWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIA
LANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGK
VPMHKLFLEMLEAKV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_996318
RefSeq Size 5262
RefSeq ORF 1305
Synonyms ERR-gamma; ERR3; ERRg; ERRgamma; NR3B3
Locus ID 2104
UniProt ID P62508
Cytogenetics 1q41
Summary This gene encodes a member of the estrogen receptor-related receptor (ESRR) family, which belongs to the nuclear hormone receptor superfamily. All members of the ESRR family share an almost identical DNA binding domain, which is composed of two C4-type zinc finger motifs. The ESRR members are orphan nuclear receptors; they bind to the estrogen response element and steroidogenic factor 1 response element, and activate genes controlled by both response elements in the absence of any ligands. The ESRR family is closely related to the estrogen receptor (ER) family. They share target genes, co-regulators and promoters, and by targeting the same set of genes, the ESRRs seem to interfere with the ER-mediated estrogen response in various ways. It has been reported that the family member encoded by this gene functions as a transcriptional activator of DNA cytosine-5-methyltransferases 1 (Dnmt1) expression by direct binding to its response elements in the DNMT1 promoters, modulates cell proliferation and estrogen signaling in breast cancer, and negatively regulates bone morphogenetic protein 2-induced osteoblast differentiation and bone formation. Multiple alternatively spliced transcript variants have been identified, which mainly differ at the 5' end and some of which encode protein isoforms differing in the N-terminal region. [provided by RefSeq, Aug 2011]
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
Write Your Own Review
You're reviewing:Estrogen Related Receptor gamma (ESRRG) (NM_206595) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH312143 ESRRG MS Standard C13 and N15-labeled recombinant protein (NP_996317) 10 ug
$3,255.00
PH318233 ESRRG MS Standard C13 and N15-labeled recombinant protein (NP_001429) 10 ug
$3,255.00
PH325714 ESRRG MS Standard C13 and N15-labeled recombinant protein (NP_001127757) 10 ug
$3,255.00
LC400557 ESRRG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404215 ESRRG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400557 Transient overexpression lysate of estrogen-related receptor gamma (ESRRG), transcript variant 1 100 ug
$665.00
LY404215 Transient overexpression lysate of estrogen-related receptor gamma (ESRRG), transcript variant 2 100 ug
$665.00
TP312143 Recombinant protein of human estrogen-related receptor gamma (ESRRG), transcript variant 2, 20 µg 20 ug
$867.00
TP314462 Purified recombinant protein of Homo sapiens estrogen-related receptor gamma (ESRRG), transcript variant 3, 20 µg 20 ug
$867.00
TP318233 Recombinant protein of human estrogen-related receptor gamma (ESRRG), transcript variant 1, 20 µg 20 ug
$867.00
TP325714 Purified recombinant protein of Homo sapiens estrogen-related receptor gamma (ESRRG), transcript variant 4, 20 µg 20 ug
$867.00
TP762660 Purified recombinant protein of Human estrogen-related receptor gamma (ESRRG), transcript variant 1, full length, with N-GST and C-His tag, expressed in E.coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.