Cyclin Y (CCNY) (NM_145012) Human Recombinant Protein

CAT#: TP317807

Purified recombinant protein of Homo sapiens cyclin Y (CCNY), transcript variant 1

Size: 20 ug 100 ug 1 mg



  View other "CCNY" proteins (5)

USD 867.00

In Stock*

Size
    • 20 ug

Product Images

Frequently bought together (2)
Cyclin Y Rabbit polyclonal Antibody
    • 100 ul

USD 313.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 412.00

Other products for "CCNY"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC217807 representing NM_145012
Red=Cloning site Green=Tags(s)

MGNTTSCCVSSSPKLRRNAHSRLESYRPDTDLSREDTGCNLQHISDRENIDDLNMEFNPSDHPRASTIFL
SKSQTDVREKRKSLFINHHPPGQIARKYSSCSTIFLDDSTVSQPNLKYTIKCVALAIYYHIKNRDPDGRM
LLDIFDENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVYLERLLTYAEIDICPA
NWKRIVLGAILLASKVWDDQAVWNVDYCQILKDITVEDMNELERQFLELLQFNINVPSSVYAKYYFDLRS
LAEANNLSFPLEPLSRERAHKLEAISRLCEDKYKDLRRSARKRSASADNLTLPRWSPAIIS

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 39.2 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Applications Cell culture: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_659449
Locus ID 219771
UniProt ID Q8ND76
Cytogenetics 10p11.21
Refseq Size 2135
Refseq ORF 1023
Synonyms C10orf9; CBCP1; CCNX; CFP1
Summary Cyclins, such as CCNY, control cell division cycles and regulate cyclin-dependent kinases (e.g., CDC2; MIM 116940) (Li et al., 2009 [PubMed 18060517]).[supplied by OMIM, May 2009]

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s)

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.