Cyclin Y (CCNY) (NM_145012) Human Mass Spec Standard

SKU
PH317807
CCNY MS Standard C13 and N15-labeled recombinant protein (NP_659449)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217807]
Predicted MW 39.2 kDa
Protein Sequence
Protein Sequence
>RC217807 representing NM_145012
Red=Cloning site Green=Tags(s)

MGNTTSCCVSSSPKLRRNAHSRLESYRPDTDLSREDTGCNLQHISDRENIDDLNMEFNPSDHPRASTIFL
SKSQTDVREKRKSLFINHHPPGQIARKYSSCSTIFLDDSTVSQPNLKYTIKCVALAIYYHIKNRDPDGRM
LLDIFDENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVYLERLLTYAEIDICPA
NWKRIVLGAILLASKVWDDQAVWNVDYCQILKDITVEDMNELERQFLELLQFNINVPSSVYAKYYFDLRS
LAEANNLSFPLEPLSRERAHKLEAISRLCEDKYKDLRRSARKRSASADNLTLPRWSPAIIS

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_659449
RefSeq Size 2135
RefSeq ORF 1023
Synonyms C10orf9; CBCP1; CCNX; CFP1
Locus ID 219771
UniProt ID Q8ND76
Cytogenetics 10p11.21
Summary Cyclins, such as CCNY, control cell division cycles and regulate cyclin-dependent kinases (e.g., CDC2; MIM 116940) (Li et al., 2009 [PubMed 18060517]).[supplied by OMIM, May 2009]
Write Your Own Review
You're reviewing:Cyclin Y (CCNY) (NM_145012) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH320991 CCNY MS Standard C13 and N15-labeled recombinant protein (NP_859049) 10 ug
$3,255.00
LC408148 CCNY HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408148 Transient overexpression lysate of cyclin Y (CCNY), transcript variant 1 100 ug
$436.00
TP317807 Purified recombinant protein of Homo sapiens cyclin Y (CCNY), transcript variant 1, 20 µg 20 ug
$737.00
TP320991 Recombinant protein of human cyclin Y (CCNY), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.