Cyclin Y (CCNY) (NM_181698) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC220991] |
Predicted MW | 39.3 kDa |
Protein Sequence |
Protein Sequence
>RC220991 representing NM_181698
Red=Cloning site Green=Tags(s) MGNTTSCCVSSSPKLRRNAHSRLESYRPDTDLSREDTGCNLQHISDRENIDDLNMEFNPSDHPRASTIFL SKSQTDVREKRKSLFINHHPPGQIARKYSSCSTIFLDDSTVSQPNLKYTIKCVALAIYYHIKNRDPDGRM LLDIFDENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVYLERLLTYAEIDICPA NWKRIVLGAILLASKVWDDQAVWNVDYCQILKDITVEDMNELERQFLELLQFNINVPSSVYAKYYFDLRS LAEANNLSFPLEPLSRERAHKLEAISRLCEDKYKDLRRSARKRSASADNLTLPRWSPAIIS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_859049 |
RefSeq Size | 4735 |
RefSeq ORF | 1023 |
Synonyms | C10orf9; CBCP1; CCNX; CFP1 |
Locus ID | 219771 |
UniProt ID | Q8ND76 |
Cytogenetics | 10p11.21 |
Summary | Cyclins, such as CCNY, control cell division cycles and regulate cyclin-dependent kinases (e.g., CDC2; MIM 116940) (Li et al., 2009 [PubMed 18060517]).[supplied by OMIM, May 2009] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH317807 | CCNY MS Standard C13 and N15-labeled recombinant protein (NP_659449) | 10 ug |
$3,255.00
|
|
LC408148 | CCNY HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY408148 | Transient overexpression lysate of cyclin Y (CCNY), transcript variant 1 | 100 ug |
$436.00
|
|
TP317807 | Purified recombinant protein of Homo sapiens cyclin Y (CCNY), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP320991 | Recombinant protein of human cyclin Y (CCNY), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.