CARHSP1 (NM_001042476) Human Recombinant Protein

SKU
TP317744
Recombinant protein of human calcium regulated heat stable protein 1, 24kDa (CARHSP1), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC217744 representing NM_001042476
Red=Cloning site Green=Tags(s)

MSSEPPPPPQPPTHQASVGLLDTPRSRERSPSPLRGNVVPSPLPTRRTRTFSATVRASQGPVYKGVCKCF
CRSKGHGFITPADGGPDIFLHISDVEGEYVPVEGDEVTYKMCSIPPKNEKLQAVEVVITHLAPGTKHETW
SGHVISS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 15.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001035941
Locus ID 23589
UniProt ID Q9Y2V2
Cytogenetics 16p13.2
RefSeq Size 3029
RefSeq ORF 441
Synonyms CRHSP-24; CRHSP24; CSDC1
Summary Binds mRNA and regulates the stability of target mRNA. Binds single-stranded DNA (in vitro).[UniProtKB/Swiss-Prot Function]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:CARHSP1 (NM_001042476) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH317744 CARHSP1 MS Standard C13 and N15-labeled recombinant protein (NP_001035941) 10 ug
$3,255.00
LC415360 CARHSP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420930 CARHSP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC425754 CARHSP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415360 Transient overexpression lysate of calcium regulated heat stable protein 1, 24kDa (CARHSP1), transcript variant 1 100 ug
$436.00
LY420930 Transient overexpression lysate of calcium regulated heat stable protein 1, 24kDa (CARHSP1), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.