CARHSP1 (NM_001042476) Human Mass Spec Standard

SKU
PH317744
CARHSP1 MS Standard C13 and N15-labeled recombinant protein (NP_001035941)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217744]
Predicted MW 15.7 kDa
Protein Sequence
Protein Sequence
>RC217744 representing NM_001042476
Red=Cloning site Green=Tags(s)

MSSEPPPPPQPPTHQASVGLLDTPRSRERSPSPLRGNVVPSPLPTRRTRTFSATVRASQGPVYKGVCKCF
CRSKGHGFITPADGGPDIFLHISDVEGEYVPVEGDEVTYKMCSIPPKNEKLQAVEVVITHLAPGTKHETW
SGHVISS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001035941
RefSeq Size 3029
RefSeq ORF 441
Synonyms CRHSP-24; CRHSP24; CSDC1
Locus ID 23589
UniProt ID Q9Y2V2
Cytogenetics 16p13.2
Summary Binds mRNA and regulates the stability of target mRNA. Binds single-stranded DNA (in vitro).[UniProtKB/Swiss-Prot Function]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:CARHSP1 (NM_001042476) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415360 CARHSP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420930 CARHSP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC425754 CARHSP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415360 Transient overexpression lysate of calcium regulated heat stable protein 1, 24kDa (CARHSP1), transcript variant 1 100 ug
$436.00
LY420930 Transient overexpression lysate of calcium regulated heat stable protein 1, 24kDa (CARHSP1), transcript variant 2 100 ug
$436.00
TP317744 Recombinant protein of human calcium regulated heat stable protein 1, 24kDa (CARHSP1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.