FOXP3 (NM_014009) Human Recombinant Protein

SKU
TP317580
Recombinant protein of human forkhead box P3 (FOXP3), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC217580 representing NM_014009
Red=Cloning site Green=Tags(s)

MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDLRGGAHASSSSLNPMPPSQLQ
LPTLPLVMVAPSGARLGPLPHLQALLQDRPHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGV
FSLKARPGLPPGINVASLEWVSREPALLCTFPNPSAPRKDSTLSAVPQSSYPLLANGVCKWPGCEKVFEE
PEDFLKHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASSDKGSC
CIVAAGSQGPVVPAWSGPREAPDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAI
LEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKRSQR
PSRCSNPTPGP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 47.1 kDa
Concentration >0.1 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Enzyme substrate (PMID: 30054205)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_054728
Locus ID 50943
UniProt ID Q9BZS1
Cytogenetics Xp11.23
RefSeq Size 1869
RefSeq ORF 1293
Synonyms AIID; DIETER; IPEX; JM2; PIDX; XPID
Summary The protein encoded by this gene is a member of the forkhead/winged-helix family of transcriptional regulators. Defects in this gene are the cause of immunodeficiency polyendocrinopathy, enteropathy, X-linked syndrome (IPEX), also known as X-linked autoimmunity-immunodeficiency syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:FOXP3 (NM_014009) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH317580 FOXP3 MS Standard C13 and N15-labeled recombinant protein (NP_054728) 10 ug
$3,255.00
LC402270 FOXP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426481 FOXP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402270 Transient overexpression lysate of forkhead box P3 (FOXP3), transcript variant 1 100 ug
$665.00
LY426481 Transient overexpression lysate of forkhead box P3 (FOXP3), transcript variant 2 100 ug
$436.00
TP760693 Purified recombinant protein of Human forkhead box P3 (FOXP3), transcript variant 2, (10ug), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.