IFRD1 (NM_001550) Human Recombinant Protein

SKU
TP317538
Recombinant protein of human interferon-related developmental regulator 1 (IFRD1), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC217538 protein sequence
Red=Cloning site Green=Tags(s)

MPKNKKRNTPHRGSSAGGGGSGAAAATAATAGGQHRNVQPFSDEDASIETMSHCSGYSDPSSFAEDGPEV
LDEEGTQEDLEYKLKGLIDLTLDKSAKTRQAALEGIKNALASKMLYEFILERRMTLTDSIERCLKKGKSD
EQRAAAALASVLCIQLGPGIESEEILKTLGPILKKIICDGSASMQARQTCATCFGVCCFIATDDITELYS
TLECLENIFTKSYLKEKDTTVICSTPNTVLHISSLLAWTLLLTICPINEVKKKLEMHFHKLPSLLSCDDV
NMRIAAGESLALLFELARGIESDFFYEDMESLTQMLRALATDGNKHRAKVDKRKQRSVFRDVLRAVEERD
FPTETIKFGPERMYIDCWVKKHTYDTFKEVLGSGMQYHLQSNEFLRNVFELGPPVMLDAATLKTMKISRF
ERHLYNSAAFKARTKARSKCRDKRADVGEFF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 50.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001541
Locus ID 3475
UniProt ID O00458
Cytogenetics 7q31.1
RefSeq Size 3305
RefSeq ORF 1353
Synonyms PC4; TIS7
Summary This gene is an immediate early gene that encodes a protein related to interferon-gamma. This protein may function as a transcriptional co-activator/repressor that controls the growth and differentiation of specific cell types during embryonic development and tissue regeneration. Mutations in this gene are associated with sensory/motor neuropathy with ataxia. This gene may also be involved in modulating the pathogenesis of cystic fibrosis lung disease. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2010]
Write Your Own Review
You're reviewing:IFRD1 (NM_001550) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH317538 IFRD1 MS Standard C13 and N15-labeled recombinant protein (NP_001541) 10 ug
$3,255.00
LC419866 IFRD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423466 IFRD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419866 Transient overexpression lysate of interferon-related developmental regulator 1 (IFRD1), transcript variant 1 100 ug
$436.00
LY423466 Transient overexpression lysate of interferon-related developmental regulator 1 (IFRD1), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.