IFRD1 (NM_001550) Human Mass Spec Standard

SKU
PH317538
IFRD1 MS Standard C13 and N15-labeled recombinant protein (NP_001541)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217538]
Predicted MW 50.3 kDa
Protein Sequence
Protein Sequence
>RC217538 protein sequence
Red=Cloning site Green=Tags(s)

MPKNKKRNTPHRGSSAGGGGSGAAAATAATAGGQHRNVQPFSDEDASIETMSHCSGYSDPSSFAEDGPEV
LDEEGTQEDLEYKLKGLIDLTLDKSAKTRQAALEGIKNALASKMLYEFILERRMTLTDSIERCLKKGKSD
EQRAAAALASVLCIQLGPGIESEEILKTLGPILKKIICDGSASMQARQTCATCFGVCCFIATDDITELYS
TLECLENIFTKSYLKEKDTTVICSTPNTVLHISSLLAWTLLLTICPINEVKKKLEMHFHKLPSLLSCDDV
NMRIAAGESLALLFELARGIESDFFYEDMESLTQMLRALATDGNKHRAKVDKRKQRSVFRDVLRAVEERD
FPTETIKFGPERMYIDCWVKKHTYDTFKEVLGSGMQYHLQSNEFLRNVFELGPPVMLDAATLKTMKISRF
ERHLYNSAAFKARTKARSKCRDKRADVGEFF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001541
RefSeq Size 3305
RefSeq ORF 1353
Synonyms PC4; TIS7
Locus ID 3475
UniProt ID O00458
Cytogenetics 7q31.1
Summary This gene is an immediate early gene that encodes a protein related to interferon-gamma. This protein may function as a transcriptional co-activator/repressor that controls the growth and differentiation of specific cell types during embryonic development and tissue regeneration. Mutations in this gene are associated with sensory/motor neuropathy with ataxia. This gene may also be involved in modulating the pathogenesis of cystic fibrosis lung disease. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2010]
Write Your Own Review
You're reviewing:IFRD1 (NM_001550) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419866 IFRD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423466 IFRD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419866 Transient overexpression lysate of interferon-related developmental regulator 1 (IFRD1), transcript variant 1 100 ug
$436.00
LY423466 Transient overexpression lysate of interferon-related developmental regulator 1 (IFRD1), transcript variant 2 100 ug
$436.00
TP317538 Recombinant protein of human interferon-related developmental regulator 1 (IFRD1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.