POFUT1 (NM_015352) Human Recombinant Protein

SKU
TP317185
Recombinant protein of human protein O-fucosyltransferase 1 (POFUT1), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC217185 representing NM_015352
Red=Cloning site Green=Tags(s)

MGAAAWARPLSVSFLLLLLPLPGMPAGSWDPAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPW
IEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTC
PMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRFSPKEHPVLALPGAPAQFPVLEEHRPLQK
YMVWSDEMVKTGEAQIHAHLVRPYVGIHLRIGSDWKNACAMLKDGTAGSHFMASPQCVGYSRSTAAPLTM
TMCLPDLKEIQRAVKLWVRSLDAQSVYVATDSESYVPELQQLFKGKVKVVSLKPEVAQVDLYILGQADHF
IGNCVSSFTAFVKRERDLQGRPSSFFGMDRPPKLRDEF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 41.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_056167
Locus ID 23509
UniProt ID Q9H488
Cytogenetics 20q11.21
RefSeq Size 5249
RefSeq ORF 1164
Synonyms DDD2; FUT12; O-Fuc-T; O-FucT-1; O-FUT; OFUCT1
Summary This gene encodes a member of the glycosyltransferase O-Fuc family. This enzyme adds O-fucose through an O-glycosidic linkage to conserved serine or threonine residues in the epidermal growth factor-like repeats of a number of cell surface and secreted proteins. O-fucose glycans are involved in ligand-induced receptor signaling. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:POFUT1 (NM_015352) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH317185 POFUT1 MS Standard C13 and N15-labeled recombinant protein (NP_056167) 10 ug
$3,255.00
LC406756 POFUT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC414612 POFUT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406756 Transient overexpression lysate of protein O-fucosyltransferase 1 (POFUT1), transcript variant 2 100 ug
$436.00
LY414612 Transient overexpression lysate of protein O-fucosyltransferase 1 (POFUT1), transcript variant 1 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.