POFUT1 (NM_015352) Human Mass Spec Standard

SKU
PH317185
POFUT1 MS Standard C13 and N15-labeled recombinant protein (NP_056167)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217185]
Predicted MW 43.96 kDa
Protein Sequence
Protein Sequence
>RC217185 representing NM_015352
Red=Cloning site Green=Tags(s)

MGAAAWARPLSVSFLLLLLPLPGMPAGSWDPAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPW
IEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTC
PMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRFSPKEHPVLALPGAPAQFPVLEEHRPLQK
YMVWSDEMVKTGEAQIHAHLVRPYVGIHLRIGSDWKNACAMLKDGTAGSHFMASPQCVGYSRSTAAPLTM
TMCLPDLKEIQRAVKLWVRSLDAQSVYVATDSESYVPELQQLFKGKVKVVSLKPEVAQVDLYILGQADHF
IGNCVSSFTAFVKRERDLQGRPSSFFGMDRPPKLRDEF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056167
RefSeq Size 5249
RefSeq ORF 1164
Synonyms DDD2; FUT12; O-Fuc-T; O-FucT-1; O-FUT; OFUCT1
Locus ID 23509
UniProt ID Q9H488
Cytogenetics 20q11.21
Summary This gene encodes a member of the glycosyltransferase O-Fuc family. This enzyme adds O-fucose through an O-glycosidic linkage to conserved serine or threonine residues in the epidermal growth factor-like repeats of a number of cell surface and secreted proteins. O-fucose glycans are involved in ligand-induced receptor signaling. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:POFUT1 (NM_015352) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406756 POFUT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC414612 POFUT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406756 Transient overexpression lysate of protein O-fucosyltransferase 1 (POFUT1), transcript variant 2 100 ug
$436.00
LY414612 Transient overexpression lysate of protein O-fucosyltransferase 1 (POFUT1), transcript variant 1 100 ug
$436.00
TP317185 Recombinant protein of human protein O-fucosyltransferase 1 (POFUT1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.