TSH beta (TSHB) (NM_000549) Human Recombinant Protein

SKU
TP316914
Purified recombinant protein of Homo sapiens thyroid stimulating hormone, beta (TSHB), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC216914 representing NM_000549
Red=Cloning site Green=Tags(s)

MTALFLMSMLFGLACGQAMSFCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQD
VCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGFSV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 13.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000540
Locus ID 7252
UniProt ID P01222
Cytogenetics 1p13.2
RefSeq Size 578
RefSeq ORF 414
Synonyms TSH-B; TSH-BETA
Summary The four human glycoprotein hormones chorionic gonadotropin (CG), luteinizing hormone (LH), follicle stimulating hormone (FSH), and thyroid stimulating hormone (TSH) are dimers consisting of alpha and beta subunits that are associated noncovalently. The alpha subunits of these hormones are identical, however, their beta chains are unique and confer biological specificity. Thyroid stimulating hormone functions in the control of thyroid structure and metabolism. The protein encoded by this gene is the beta subunit of thyroid stimulating hormone. Mutations in this gene are associated with congenital central and secondary hypothyroidism and Hashimoto's thyroiditis. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, May 2013]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Autoimmune thyroid disease, Neuroactive ligand-receptor interaction
Write Your Own Review
You're reviewing:TSH beta (TSHB) (NM_000549) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH316914 TSHB MS Standard C13 and N15-labeled recombinant protein (NP_000540) 10 ug
$3,255.00
LC424650 TSHB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424650 Transient overexpression lysate of thyroid stimulating hormone, beta (TSHB) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.