Apolipoprotein L 2 (APOL2) (NM_145637) Human Recombinant Protein

SKU
TP316858
Recombinant protein of human apolipoprotein L, 2 (APOL2), transcript variant beta, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC216858 protein sequence
Red=Cloning site Green=Tags(s)

MNPESSIFIEDYLKYFQDQVSRENLLQLLTDDEAWNGFVAAAELPRDEADELRKALNKLASHMVMKDKNR
HDKDQQHRQWFLKEFPRLKRELEDHIRKLRALAEEVEQVHRGTTIANVVSNSVGTTSGILTLLGLGLAPF
TEGISFVLLDTGMGLGAAAAVAGITCSVVELVNKLRARAQARNLDQSGTNVAKVMKEFVGGNTPNVLTLV
DNWYQVTQGIGRNIRAIRRARANPQLGAYAPPPHVIGRISAEGGEQVERVVEGPAQAMSRGTMIVGAATG
GILLLLDVVSLAYESKHLLEGAKSESAEELKKRAQELEGKLNFLTKIHEMLQPGQDQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 36.9 kDa
Concentration >0.1 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_663612
Locus ID 23780
UniProt ID Q9BQE5
Cytogenetics 22q12.3
RefSeq Size 2686
RefSeq ORF 1011
Synonyms APOL-II; APOL3
Summary This gene is a member of the apolipoprotein L gene family. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids or allow the binding of lipids to organelles. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:Apolipoprotein L 2 (APOL2) (NM_145637) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302585 APOL2 MS Standard C13 and N15-labeled recombinant protein (NP_112092) 10 ug
$3,255.00
PH316858 APOL2 MS Standard C13 and N15-labeled recombinant protein (NP_663612) 10 ug
$3,255.00
LC403087 APOL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC407937 APOL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403087 Transient overexpression lysate of apolipoprotein L, 2 (APOL2), transcript variant alpha 100 ug
$436.00
LY407937 Transient overexpression lysate of apolipoprotein L, 2 (APOL2), transcript variant beta 100 ug
$436.00
TP302585 Recombinant protein of human apolipoprotein L, 2 (APOL2), transcript variant alpha, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.