Apolipoprotein L 2 (APOL2) (NM_030882) Human Mass Spec Standard

SKU
PH302585
APOL2 MS Standard C13 and N15-labeled recombinant protein (NP_112092)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202585]
Predicted MW 37.1 kDa
Protein Sequence
Protein Sequence
>RC202585 protein sequence
Red=Cloning site Green=Tags(s)

MNPESSIFIEDYLKYFQDQVSRENLLQLLTDDEAWNGFVAAAELPRDEADELRKALNKLASHMVMKDKNR
HDKDQQHRQWFLKEFPRLKRELEDHIRKLRALAEEVEQVHRGTTIANVVSNSVGTTSGILTLLGLGLAPF
TEGISFVLLDTGMGLGAAAAVAGITCSVVELVNKLRARAQARNLDQSGTNVAKVMKEFVGGNTPNVLTLV
DNWYQVTQGIGRNIRAIRRARANPQLGAYAPPPHVIGRISAEGGEQVERVVEGPAQAMSRGTMIVGAATG
GILLLLDVVSLAYESKHLLEGAKSESAEELKKRAQELEGKLNFLTKIHEMLQPGQDQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_112092
RefSeq Size 2545
RefSeq ORF 1011
Synonyms APOL-II; APOL3
Locus ID 23780
UniProt ID Q9BQE5
Cytogenetics 22q12.3
Summary This gene is a member of the apolipoprotein L gene family. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids or allow the binding of lipids to organelles. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:Apolipoprotein L 2 (APOL2) (NM_030882) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH316858 APOL2 MS Standard C13 and N15-labeled recombinant protein (NP_663612) 10 ug
$3,255.00
LC403087 APOL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC407937 APOL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403087 Transient overexpression lysate of apolipoprotein L, 2 (APOL2), transcript variant alpha 100 ug
$436.00
LY407937 Transient overexpression lysate of apolipoprotein L, 2 (APOL2), transcript variant beta 100 ug
$436.00
TP302585 Recombinant protein of human apolipoprotein L, 2 (APOL2), transcript variant alpha, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP316858 Recombinant protein of human apolipoprotein L, 2 (APOL2), transcript variant beta, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.