ARHGEF9 (NM_015185) Human Recombinant Protein

SKU
TP316681
Recombinant protein of human Cdc42 guanine nucleotide exchange factor (GEF) 9 (ARHGEF9), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC216681 representing NM_015185
Red=Cloning site Green=Tags(s)

MTLLITGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVRLWVNQED
EVEEGPSDVQNGHLDPNSDCLCLGRPLQNRDQMRANVINEIMSTERHYIKHLKDICEGYLKQCRKRRDMF
SDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEIGPCFLEHQDGFWIYSEYCNNHLDACMELSK
LMKDSRYQHFFEACRLLQQMIDIAIDGFLLTLVQKICKYPLQLAELLKYTAQDHSDYRYVAAALAVMRNV
TQQINERKRRLENIDKIAQWQASVLDWEGEDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLC
KKDLIRRDILYYKGRIDMDKYEVVDIEDGRDDDFNVSMKNAFKLHNKETEEIHLFFAKKLEEKIRWLRAF
REERKMVQEDEKIGFEISENQKRQAAMTVRKVPKQKGVNSARSVPPSYPPPQDPLNHGQYLVPDGIAQSQ
VFEFTEPKRSQSPFWQNFSRLTPFKK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 60.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_056000
Locus ID 23229
UniProt ID O43307
Cytogenetics Xq11.1
RefSeq Size 5413
RefSeq ORF 1548
Synonyms COLLYBISTIN; DEE8; EIEE8; HPEM-2; PEM-2; PEM2
Summary The protein encoded by this gene is a Rho-like GTPase that switches between the active (GTP-bound) state and inactive (GDP-bound) state to regulate CDC42 and other genes. This brain-specific protein also acts as an adaptor protein for the recruitment of gephyrin and together these proteins facilitate receceptor recruitement in GABAnergic and glycinergic synapses. Defects in this gene are the cause of startle disease with epilepsy (STHEE), also known as hyperekplexia with epilepsy, as well as several other types of cognitive disability. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2017]
Write Your Own Review
You're reviewing:ARHGEF9 (NM_015185) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH316681 ARHGEF9 MS Standard C13 and N15-labeled recombinant protein (NP_056000) 10 ug
$3,255.00
LC414739 ARHGEF9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433127 ARHGEF9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414739 Transient overexpression lysate of Cdc42 guanine nucleotide exchange factor (GEF) 9 (ARHGEF9) 100 ug
$665.00
LY433127 Transient overexpression lysate of Cdc42 guanine nucleotide exchange factor (GEF) 9 (ARHGEF9), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.