ARHGEF9 (NM_015185) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC216681] |
Predicted MW | 60.8 kDa |
Protein Sequence |
Protein Sequence
>RC216681 representing NM_015185
Red=Cloning site Green=Tags(s) MTLLITGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVRLWVNQED EVEEGPSDVQNGHLDPNSDCLCLGRPLQNRDQMRANVINEIMSTERHYIKHLKDICEGYLKQCRKRRDMF SDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEIGPCFLEHQDGFWIYSEYCNNHLDACMELSK LMKDSRYQHFFEACRLLQQMIDIAIDGFLLTLVQKICKYPLQLAELLKYTAQDHSDYRYVAAALAVMRNV TQQINERKRRLENIDKIAQWQASVLDWEGEDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLC KKDLIRRDILYYKGRIDMDKYEVVDIEDGRDDDFNVSMKNAFKLHNKETEEIHLFFAKKLEEKIRWLRAF REERKMVQEDEKIGFEISENQKRQAAMTVRKVPKQKGVNSARSVPPSYPPPQDPLNHGQYLVPDGIAQSQ VFEFTEPKRSQSPFWQNFSRLTPFKK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_056000 |
RefSeq Size | 5413 |
RefSeq ORF | 1548 |
Synonyms | COLLYBISTIN; DEE8; EIEE8; HPEM-2; PEM-2; PEM2 |
Locus ID | 23229 |
UniProt ID | O43307 |
Cytogenetics | Xq11.1 |
Summary | The protein encoded by this gene is a Rho-like GTPase that switches between the active (GTP-bound) state and inactive (GDP-bound) state to regulate CDC42 and other genes. This brain-specific protein also acts as an adaptor protein for the recruitment of gephyrin and together these proteins facilitate receceptor recruitement in GABAnergic and glycinergic synapses. Defects in this gene are the cause of startle disease with epilepsy (STHEE), also known as hyperekplexia with epilepsy, as well as several other types of cognitive disability. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2017] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC414739 | ARHGEF9 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC433127 | ARHGEF9 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY414739 | Transient overexpression lysate of Cdc42 guanine nucleotide exchange factor (GEF) 9 (ARHGEF9) | 100 ug |
$665.00
|
|
LY433127 | Transient overexpression lysate of Cdc42 guanine nucleotide exchange factor (GEF) 9 (ARHGEF9), transcript variant 2 | 100 ug |
$436.00
|
|
TP316681 | Recombinant protein of human Cdc42 guanine nucleotide exchange factor (GEF) 9 (ARHGEF9), 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.