BPNT1 (NM_006085) Human Recombinant Protein

SKU
TP316622
Recombinant protein of human 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC216622 representing NM_006085
Red=Cloning site Green=Tags(s)

MASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLT
IIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIA
YEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQLKEVPAGKHIITTTRSHSNKLVTDCVAAM
NPDAVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMN
SAGVLATLRNYDYYASRVPESIKNALVP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 33.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006076
Locus ID 10380
UniProt ID O95861
Cytogenetics 1q41
RefSeq Size 2461
RefSeq ORF 924
Synonyms HEL20; PIP
Summary BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity. [provided by RefSeq, Jul 2008]
Protein Pathways Sulfur metabolism
Write Your Own Review
You're reviewing:BPNT1 (NM_006085) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH316622 BPNT1 MS Standard C13 and N15-labeled recombinant protein (NP_006076) 10 ug
$3,255.00
LC416871 BPNT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416871 Transient overexpression lysate of 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.