OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BPNT1 (NM_006085) Human Mass Spec Standard

Be the first to review this product
SKU
PH316622
BPNT1 MS Standard C13 and N15-labeled recombinant protein (NP_006076)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA303272 Goat Polyclonal Antibody against BPNT1
100 ug
$565.00
LY416871 Transient overexpression lysate of 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1) (as WB positive control) 100 ug
$436.00

Other products for "BPNT1 or NM_006085"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC216622
Predicted MW 33.2 kDa
Protein Sequence
Protein Sequence
>RC216622 representing NM_006085
Red=Cloning site Green=Tags(s)

MASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLT
IIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIA
YEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQLKEVPAGKHIITTTRSHSNKLVTDCVAAM
NPDAVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMN
SAGVLATLRNYDYYASRVPESIKNALVP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006076
RefSeq Size 2461
RefSeq ORF 924
Synonyms HEL20; PIP
Locus ID 10380
UniProt ID O95861
Cytogenetics 1q41
Summary BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity. provided by RefSeq, Jul 2008
Protein Pathways Sulfur metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BPNT1" proteins (3)
SKU Description Size Price
LC416871 Lyophilized BPNT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416871 Transient overexpression lysate of 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1) (as WB positive control) 100 ug
$436.00
TP316622 Recombinant protein of human 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products