PYCR1 (NM_153824) Human Recombinant Protein

SKU
TP316359
Recombinant protein of human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC216359 representing NM_153824
Red=Cloning site Green=Tags(s)

MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAV
KPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTH
AQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQAL
LGAAKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIRTRELQSMADQEQVSPA
AIKKTILDKDHLPLELGSPEGLHPLLLQYQLARAPS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 33.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_722546
Locus ID 5831
UniProt ID P32322
Cytogenetics 17q25.3
RefSeq Size 1768
RefSeq ORF 948
Synonyms ARCL2B; ARCL3B; P5C; P5CR; PIG45; PP222; PRO3; PYCR
Summary This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types. The protein forms a homopolymer and localizes to the mitochondrion. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
Protein Pathways Arginine and proline metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:PYCR1 (NM_153824) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH310027 PYCR1 MS Standard C13 and N15-labeled recombinant protein (NP_008838) 10 ug
$3,255.00
PH316359 PYCR1 MS Standard C13 and N15-labeled recombinant protein (NP_722546) 10 ug
$3,255.00
LC406968 PYCR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC416328 PYCR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406968 Transient overexpression lysate of pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2 100 ug
$436.00
LY416328 Transient overexpression lysate of pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1 100 ug
$436.00
TP310027 Recombinant protein of human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.