OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PYCR1 (NM_006907) Human Mass Spec Standard

Be the first to review this product
SKU
PH310027
PYCR1 MS Standard C13 and N15-labeled recombinant protein (NP_008838)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA811756 PYCR1 mouse monoclonal antibody,clone OTI4F2 100 ul
$447.00
LY406968 Transient overexpression lysate of pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "PYCR1 or NM_006907"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210027
Predicted MW 33.2 kDa
Protein Sequence
Protein Sequence
>RC210027 representing NM_006907
Red=Cloning site Green=Tags(s)

MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAV
KPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTH
AQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQAL
LGAAKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIRTRELQSMADQEQVSPA
AIKKTILDKVKLDSPAGTALSPSGHTKLLPRSLAPAGKD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_008838
RefSeq Size 2059
RefSeq ORF 957
Synonyms ARCL2B; ARCL3B; P5C; P5CR; PIG45; PP222; PRO3; PYCR
Locus ID 5831
UniProt ID P32322
Cytogenetics 17q25.3
Summary This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types. The protein forms a homopolymer and localizes to the mitochondrion. Alternative splicing results in multiple transcript variants. provided by RefSeq, Aug 2013
Protein Pathways Arginine and proline metabolism, Metabolic pathways
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PYCR1" proteins (7)
SKU Description Size Price
PH316359 PYCR1 MS Standard C13 and N15-labeled recombinant protein (NP_722546) 10 ug
$3,360.00
LC406968 Lyophilized PYCR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC416328 Lyophilized PYCR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406968 Transient overexpression lysate of pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY416328 Transient overexpression lysate of pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP310027 Recombinant protein of human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1, 20 µg 20 ug
$867.00
TP316359 Recombinant protein of human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products