TMEM41B (NM_015012) Human Recombinant Protein

SKU
TP316351
Recombinant protein of human transmembrane protein 41B (TMEM41B), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC216351 protein sequence
Red=Cloning site Green=Tags(s)

MAKGRVAERSQLGAHHTTPVGDGAAGTRGLAAPGSRDHQKEKSWVEAGSARMSLLILVSIFLSAAFVMFL
VYKNFPQLSEEERVNMKVPRDMDDAKALGKVLSKYKDTFYVQVLVAYFATYIFLQTFAIPGSIFLSILSG
FLYPFPLALFLVCLCSGLGASFCYMLSYLVGRPVVYKYLTEKAVKWSQQVERHREHLINYIIFLRITPFL
PNWFINITSPVINVPLKVFFIGTFLGVAPPSFVAIKAGTTLYQLTTAGEAVSWNSIFILMILAVLSILPA
IFQKKLKQKFE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 32.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_055827
Locus ID 440026
UniProt ID Q5BJD5
Cytogenetics 11p15.4
RefSeq Size 3973
RefSeq ORF 873
Summary Required for normal motor neuron development (By similarity). Required for autophagosome formation (PubMed:30093494).[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:TMEM41B (NM_015012) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH316351 TMEM41B MS Standard C13 and N15-labeled recombinant protein (NP_055827) 10 ug
$3,255.00
LC414863 TMEM41B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414863 Transient overexpression lysate of transmembrane protein 41B (TMEM41B), transcript variant 1 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.