PDE6 gamma (PDE6G) (NM_002602) Human Recombinant Protein
SKU
TP316236
Recombinant protein of human phosphodiesterase 6G, cGMP-specific, rod, gamma (PDE6G), transcript variant 1, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC216236 protein sequence
Red=Cloning site Green=Tags(s) MNLEPPKAEFRSATRVAGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGLGTDITVICPW EAFNHLELHELAQYGII myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_002593 |
Locus ID | 5148 |
UniProt ID | P18545 |
Cytogenetics | 17q25.3 |
RefSeq Size | 1064 |
RefSeq ORF | 261 |
Synonyms | PDEG; RP57 |
Summary | This gene encodes the gamma subunit of cyclic GMP-phosphodiesterase, which is composed of alpha- and beta- catalytic subunits and two identical, inhibitory gamma subunits. This gene is expressed in rod photoreceptors and functions in the phototransduction signaling cascade. It is also expressed in a variety of other tissues, and has been shown to regulate the c-Src protein kinase and G-protein-coupled receptor kinase 2. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Progesterone-mediated oocyte maturation, Purine metabolism |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH316236 | PDE6G MS Standard C13 and N15-labeled recombinant protein (NP_002593) | 10 ug |
$3,255.00
|
|
LC419220 | PDE6G HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY419220 | Transient overexpression lysate of phosphodiesterase 6G, cGMP-specific, rod, gamma (PDE6G), transcript variant 1 | 100 ug |
$436.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.