PDE6 gamma (PDE6G) (NM_002602) Human Tagged ORF Clone

SKU
RC216236
PDE6G (Myc-DDK-tagged)-Human phosphodiesterase 6G, cGMP-specific, rod, gamma (PDE6G), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PDE6 gamma
Synonyms PDEG; RP57
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC216236 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACCTGGAACCGCCCAAGGCTGAGTTCCGGTCAGCCACCAGGGTGGCCGGGGGACCTGTCACCCCCA
GGAAAGGGCCCCCTAAATTTAAGCAGCGACAGACCAGGCAGTTCAAGAGCAAGCCCCCAAAGAAAGGCGT
TCAAGGGTTTGGGGACGACATCCCTGGAATGGAAGGCCTGGGAACAGACATCACAGTCATCTGCCCTTGG
GAGGCCTTCAACCACCTGGAGCTGCACGAGCTGGCCCAATATGGCATCATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC216236 protein sequence
Red=Cloning site Green=Tags(s)

MNLEPPKAEFRSATRVAGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGLGTDITVICPW
EAFNHLELHELAQYGII

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002602
ORF Size 261 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002602.4
RefSeq Size 1064 bp
RefSeq ORF 264 bp
Locus ID 5148
UniProt ID P18545
Cytogenetics 17q25.3
Protein Families Druggable Genome
Protein Pathways Progesterone-mediated oocyte maturation, Purine metabolism
MW 9.6 kDa
Summary This gene encodes the gamma subunit of cyclic GMP-phosphodiesterase, which is composed of alpha- and beta- catalytic subunits and two identical, inhibitory gamma subunits. This gene is expressed in rod photoreceptors and functions in the phototransduction signaling cascade. It is also expressed in a variety of other tissues, and has been shown to regulate the c-Src protein kinase and G-protein-coupled receptor kinase 2. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2009]
Write Your Own Review
You're reviewing:PDE6 gamma (PDE6G) (NM_002602) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC216236L3 Lenti ORF clone of Human phosphodiesterase 6G, cGMP-specific, rod, gamma (PDE6G), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC216236L4 Lenti ORF clone of Human phosphodiesterase 6G, cGMP-specific, rod, gamma (PDE6G), transcript variant 1, mGFP tagged 10 ug
$450.00
RG216236 PDE6G (tGFP-tagged) - Human phosphodiesterase 6G, cGMP-specific, rod, gamma (PDE6G), transcript variant 1 10 ug
$350.00
SC303224 PDE6G (untagged)-Human phosphodiesterase 6G, cGMP-specific, rod, gamma (PDE6G), transcript variant 1 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.