Shugoshin (SGO1) (NM_001012413) Human Recombinant Protein

SKU
TP316188
Recombinant protein of human shugoshin-like 1 (S. pombe) (SGOL1), transcript variant C1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC216188 representing NM_001012413
Red=Cloning site Green=Tags(s)

MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALEN
EKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQ
IPLEETELPGQGESFQIEATPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCT
ASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKSMKQIQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 29.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001012413
Locus ID 151648
UniProt ID Q5FBB7
Cytogenetics 3p24.3
RefSeq Size 1149
RefSeq ORF 774
Synonyms CAID; NY-BR-85; SGO; SGOL1
Summary The protein encoded by this gene is a member of the shugoshin family of proteins. This protein is thought to protect centromeric cohesin from cleavage during mitotic prophase by preventing phosphorylation of a cohesin subunit. Reduced expression of this gene leads to the premature loss of centromeric cohesion, mis-segregation of sister chromatids, and mitotic arrest. Evidence suggests that this protein also protects a small subset of cohesin found along the length of the chromosome arms during mitotic prophase. An isoform lacking exon 6 has been shown to play a role in the cohesion of centrioles (PMID: 16582621 and PMID:18331714). Mutations in this gene have been associated with Chronic Atrial and Intestinal Dysrhythmia (CAID) syndrome, characterized by the co-occurrence of Sick Sinus Syndrome (SSS) and Chronic Intestinal Pseudo-obstruction (CIPO) within the first four decades of life (PMID:25282101). Fibroblast cells from CAID patients exhibited both increased cell proliferation and higher rates of senescence. Pseudogenes of this gene have been found on chromosomes 1 and 7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2015]
Protein Pathways Oocyte meiosis
Write Your Own Review
You're reviewing:Shugoshin (SGO1) (NM_001012413) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH313965 SGOL1 MS Standard C13 and N15-labeled recombinant protein (NP_001012411) 10 ug
$3,255.00
PH316188 SGOL1 MS Standard C13 and N15-labeled recombinant protein (NP_001012413) 10 ug
$3,255.00
LC408583 SGOL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422848 SGOL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422849 SGOL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422850 SGOL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422851 SGOL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408583 Transient overexpression lysate of shugoshin-like 1 (S. pombe) (SGOL1), transcript variant C2 100 ug
$436.00
LY422848 Transient overexpression lysate of shugoshin-like 1 (S. pombe) (SGOL1), transcript variant A2 100 ug
$665.00
LY422849 Transient overexpression lysate of shugoshin-like 1 (S. pombe) (SGOL1), transcript variant B1 100 ug
$436.00
LY422850 Transient overexpression lysate of shugoshin-like 1 (S. pombe) (SGOL1), transcript variant B2 100 ug
$436.00
LY422851 Transient overexpression lysate of shugoshin-like 1 (S. pombe) (SGOL1), transcript variant C1 100 ug
$436.00
TP313965 Recombinant protein of human shugoshin-like 1 (S. pombe) (SGOL1), transcript variant B1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.