Shugoshin (SGO1) (NM_001012413) Human Mass Spec Standard

SKU
PH316188
SGOL1 MS Standard C13 and N15-labeled recombinant protein (NP_001012413)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216188]
Predicted MW 29.3 kDa
Protein Sequence
Protein Sequence
>RC216188 representing NM_001012413
Red=Cloning site Green=Tags(s)

MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALEN
EKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQ
IPLEETELPGQGESFQIEATPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCT
ASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKSMKQIQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001012413
RefSeq Size 1149
RefSeq ORF 774
Synonyms CAID; NY-BR-85; SGO; SGOL1
Locus ID 151648
UniProt ID Q5FBB7
Cytogenetics 3p24.3
Summary The protein encoded by this gene is a member of the shugoshin family of proteins. This protein is thought to protect centromeric cohesin from cleavage during mitotic prophase by preventing phosphorylation of a cohesin subunit. Reduced expression of this gene leads to the premature loss of centromeric cohesion, mis-segregation of sister chromatids, and mitotic arrest. Evidence suggests that this protein also protects a small subset of cohesin found along the length of the chromosome arms during mitotic prophase. An isoform lacking exon 6 has been shown to play a role in the cohesion of centrioles (PMID: 16582621 and PMID:18331714). Mutations in this gene have been associated with Chronic Atrial and Intestinal Dysrhythmia (CAID) syndrome, characterized by the co-occurrence of Sick Sinus Syndrome (SSS) and Chronic Intestinal Pseudo-obstruction (CIPO) within the first four decades of life (PMID:25282101). Fibroblast cells from CAID patients exhibited both increased cell proliferation and higher rates of senescence. Pseudogenes of this gene have been found on chromosomes 1 and 7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2015]
Protein Pathways Oocyte meiosis
Write Your Own Review
You're reviewing:Shugoshin (SGO1) (NM_001012413) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH313965 SGOL1 MS Standard C13 and N15-labeled recombinant protein (NP_001012411) 10 ug
$3,255.00
LC408583 SGOL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422848 SGOL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422849 SGOL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422850 SGOL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422851 SGOL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408583 Transient overexpression lysate of shugoshin-like 1 (S. pombe) (SGOL1), transcript variant C2 100 ug
$436.00
LY422848 Transient overexpression lysate of shugoshin-like 1 (S. pombe) (SGOL1), transcript variant A2 100 ug
$665.00
LY422849 Transient overexpression lysate of shugoshin-like 1 (S. pombe) (SGOL1), transcript variant B1 100 ug
$436.00
LY422850 Transient overexpression lysate of shugoshin-like 1 (S. pombe) (SGOL1), transcript variant B2 100 ug
$436.00
LY422851 Transient overexpression lysate of shugoshin-like 1 (S. pombe) (SGOL1), transcript variant C1 100 ug
$436.00
TP313965 Recombinant protein of human shugoshin-like 1 (S. pombe) (SGOL1), transcript variant B1, 20 µg 20 ug
$737.00
TP316188 Recombinant protein of human shugoshin-like 1 (S. pombe) (SGOL1), transcript variant C1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.