Von Hippel Lindau (VHL) (NM_000551) Human Recombinant Protein

SKU
TP316151
Recombinant protein of human von Hippel-Lindau tumor suppressor (VHL), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC216151 representing NM_000551
Red=Cloning site Green=Tags(s)

MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSRE
PSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSL
NVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQR
MGD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 24 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Binding assay (PMID: 27780863)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000542
Locus ID 7428
UniProt ID P40337
Cytogenetics 3p25.3
RefSeq Size 2968
RefSeq ORF 639
Synonyms HRCA1; pVHL; RCA1; VHL1
Summary Von Hippel-Lindau syndrome (VHL) is a dominantly inherited familial cancer syndrome predisposing to a variety of malignant and benign tumors. A germline mutation of this gene is the basis of familial inheritance of VHL syndrome. The protein encoded by this gene is a component of the protein complex that includes elongin B, elongin C, and cullin-2, and possesses ubiquitin ligase E3 activity. This protein is involved in the ubiquitination and degradation of hypoxia-inducible-factor (HIF), which is a transcription factor that plays a central role in the regulation of gene expression by oxygen. RNA polymerase II subunit POLR2G/RPB7 is also reported to be a target of this protein. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Pathways in cancer, Renal cell carcinoma, Ubiquitin mediated proteolysis
Write Your Own Review
You're reviewing:Von Hippel Lindau (VHL) (NM_000551) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH316151 VHL MS Standard C13 and N15-labeled recombinant protein (NP_000542) 10 ug
$3,255.00
LC400188 VHL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404985 VHL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400188 Transient overexpression lysate of von Hippel-Lindau tumor suppressor (VHL), transcript variant 1 100 ug
$436.00
LY404985 Transient overexpression lysate of von Hippel-Lindau tumor suppressor (VHL), transcript variant 2 100 ug
$436.00
TP760451 Purified recombinant protein of Human von Hippel-Lindau tumor suppressor (VHL), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.