POU4F2 (NM_004575) Human Recombinant Protein
SKU
TP315962
Purified recombinant protein of Homo sapiens POU class 4 homeobox 2 (POU4F2), 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC215962 representing NM_004575
Red=Cloning site Green=Tags(s) MMMMSLNSKQAFSMPHGGSLHVEPKYSALHSTSPGSSAPIAPSASSPSSSSNAGGGGGGGGGGGGGGGGR SSSSSSSGSSGGGGSEAMRRACLPTPPSNIFGGLDESLLARAEALAAVDIVSQSKSHHHHPPHHSPFKPD ATYHTMNTIPCTSAASSSSVPISHPCALAGTHHHHHHHHHHHHQPHQALEGELLEHLSPGLALGAMAGPD GAVVSTPAHAPHMATMNPMHQAALSMAHAHGLPSHMGCMSDVDADPRDLEAFAERFKQRRIKLGVTQADV GSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEKSHREKLTKPELFNGAEKKRKR TSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAGI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_004566 |
Locus ID | 5458 |
UniProt ID | Q12837 |
Cytogenetics | 4q31.22 |
RefSeq Size | 3110 |
RefSeq ORF | 1230 |
Synonyms | Brn-3b; BRN3.2; BRN3B |
Summary | The protein encoded by this gene is a member of the POU-domain transcription factor family and may be involved in maintaining visual system neurons in the retina. The level of the encoded protein is also elevated in a majority of breast cancers, resulting in accelerated tumor growth. [provided by RefSeq, Sep 2011] |
Protein Families | Transcription Factors |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH315962 | POU4F2 MS Standard C13 and N15-labeled recombinant protein (NP_004566) | 10 ug |
$3,255.00
|
|
LC417894 | POU4F2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY417894 | Transient overexpression lysate of POU class 4 homeobox 2 (POU4F2) | 100 ug |
$436.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.