POU4F2 (NM_004575) Human Mass Spec Standard

SKU
PH315962
POU4F2 MS Standard C13 and N15-labeled recombinant protein (NP_004566)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215962]
Predicted MW 42.9 kDa
Protein Sequence
Protein Sequence
>RC215962 representing NM_004575
Red=Cloning site Green=Tags(s)

MMMMSLNSKQAFSMPHGGSLHVEPKYSALHSTSPGSSAPIAPSASSPSSSSNAGGGGGGGGGGGGGGGGR
SSSSSSSGSSGGGGSEAMRRACLPTPPSNIFGGLDESLLARAEALAAVDIVSQSKSHHHHPPHHSPFKPD
ATYHTMNTIPCTSAASSSSVPISHPCALAGTHHHHHHHHHHHHQPHQALEGELLEHLSPGLALGAMAGPD
GAVVSTPAHAPHMATMNPMHQAALSMAHAHGLPSHMGCMSDVDADPRDLEAFAERFKQRRIKLGVTQADV
GSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEKSHREKLTKPELFNGAEKKRKR
TSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAGI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004566
RefSeq Size 3110
RefSeq ORF 1230
Synonyms Brn-3b; BRN3.2; BRN3B
Locus ID 5458
UniProt ID Q12837
Cytogenetics 4q31.22
Summary The protein encoded by this gene is a member of the POU-domain transcription factor family and may be involved in maintaining visual system neurons in the retina. The level of the encoded protein is also elevated in a majority of breast cancers, resulting in accelerated tumor growth. [provided by RefSeq, Sep 2011]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:POU4F2 (NM_004575) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417894 POU4F2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417894 Transient overexpression lysate of POU class 4 homeobox 2 (POU4F2) 100 ug
$436.00
TP315962 Purified recombinant protein of Homo sapiens POU class 4 homeobox 2 (POU4F2), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.